DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6791 and ZNF665

DIOPT Version :9

Sequence 1:NP_650090.1 Gene:CG6791 / 41391 FlyBaseID:FBgn0037918 Length:1243 Species:Drosophila melanogaster
Sequence 2:NP_001340387.1 Gene:ZNF665 / 79788 HGNCID:25885 Length:706 Species:Homo sapiens


Alignment Length:941 Identity:181/941 - (19%)
Similarity:279/941 - (29%) Gaps:406/941 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 MQRHSFPG-AGGRPRLGSGLSVRPTTSQINATDENGVPINYELGVVYICPACGGEFRQQDHWK-- 181
            :|:.:.|| ...|.|..:|          |...||      :|||.:           |.|..  
Human   143 LQKENLPGRRAQRDRRAAG----------NRHIEN------QLGVSF-----------QSHLPEL 180

  Fly   182 ---RHMNHIHKYNTL------RGLNFTPLDKLYQRCRECNKRIAMHSRENLLKHKFTHL---PFR 234
               :|...|::||.:      ||.::        :|.||.|..:.:||  |..||..|.   |::
Human   181 QQFQHEGKIYEYNQVEKSPNNRGKHY--------KCDECGKVFSQNSR--LTSHKRIHTGEKPYQ 235

  Fly   235 CTKCYICKREYKYRQDLMVHLRMVH-------CDEVVAMMREGYNAAGRKTRVRESRTEQLLREK 292
            |.|   |.:.:..|.:|.:| :::|       |:|...:..:..|.||.: |:.           
Human   236 CNK---CGKAFTVRSNLTIH-QVIHTGEKPYKCNECGKVFSQPSNLAGHQ-RIH----------- 284

  Fly   293 SFRENDDLGEESDRIEVRNELLEPDADESGTQEQTVSEEVSKKKAGTRGAAELCEDYIHYMCPDC 357
                   .||:.                                               |.|.:|
Human   285 -------TGEKP-----------------------------------------------YKCNEC 295

  Fly   358 GTDCDTHAQWSQHIEFVHDYVSRRGLNFRSVDMQMQCLECKKIVTPNTIKSLRAHKFSHLSQPEW 422
            |.....|::.:.| :.:|           :.:...:|.||.|..|.|:  .|.:|:..|..:..:
Human   296 GKAFRAHSKLTTH-QVIH-----------TGEKPYKCKECGKCFTQNS--HLASHRRIHTGEKPY 346

  Fly   423 LRCKLCYKGYTDHQEIIRHLLQQHHMDTLMSEDAEEEDGDAPSAIEDECDGDNGNGEGNGAPLDE 487
             :|..|.|.::....:..|  |..|            .|:.|... :||          |.....
Human   347 -KCNECGKAFSVRSSLTTH--QTIH------------TGEKPYKC-NEC----------GKVFRH 385

  Fly   488 DSPYFEDAPRRGGRISSDDIFEPHIDYLCPQCGKEFIEKKHWRTHVVMAHSMNDLSKLNFEMINE 552
            :| |.  |..|  ||.:.:  :|   |.|.:|||.|           ..||  :|:|.......|
Human   386 NS-YL--AKHR--RIHTGE--KP---YKCNECGKAF-----------SMHS--NLTKHQIIHTGE 427

  Fly   553 RQLKCTECDKIITNAYGIQNAQQHRITHLPFKAYARCRKCHKSYTDRKGLVKHLATHHRVGWPRK 617
            :..||.||.|:.|....:.|   ||..|...|.| ||.:|.|:::.|..|..|.|.|        
Human   428 KPFKCNECVKVFTQYSHLAN---HRRIHTGEKPY-RCDECGKAFSVRSSLTTHQAIH-------- 480

  Fly   618 LSGGCPAPILTPAKQPRKQIVTVANETYEIIYLDDVDQGGMEEDNDFGEQMQAEEDEYPIAPPPP 682
             :|..|                                                           
Human   481 -TGEKP----------------------------------------------------------- 485

  Fly   683 SPPPPPQPTTQGNHQRYKCVHCGTLFATQAAVRVHISEKRCRKTVVRRRRQPVMSSADPSVPTVE 747
                            |||..||.:|...:    |::..|           .:.|...|      
Human   486 ----------------YKCNDCGKVFTQNS----HLASHR-----------GIHSGEKP------ 513

  Fly   748 QNYIFLCPSCGFEYKTQFEWRRHINEVHNFDKRQYLNMRQLDKYRYQCTQC-KDIVCNSKLKGLQ 811
                :.|..||..:....:..||. .||..:|            .|:|.:| |....:|.|...|
Human   514 ----YKCDECGKAFSQTSQLARHW-RVHTGEK------------PYKCNECGKAFSVHSSLTIHQ 561

  Fly   812 DHHFRHLPYRLYLKCLICGTCYNHKPNIAAHLRARHSIFDRETPTMITKPKQVLGRYKDNSRENP 876
            ..|....||    ||..||..:.|...:|.|.|    |...|.|            ||.|.    
Human   562 TIHTGQKPY----KCNDCGKVFRHNSYLAIHQR----IHTGEKP------------YKCNE---- 602

  Fly   877 KLPSPPPAPALAPAPPSPPACSSSAAASASSRSLKPQPGGLPARPAGLNTLEDSISYHNAVDLDF 941
                                |..:.                        ::..:::.|..:....
Human   603 --------------------CGKAF------------------------SVHSNLATHQVIHTGE 623

  Fly   942 ITYFCPKCNQNFDSHAFWRKHIVEQHNFNSREGLNFRQIDNHHYLCLECYKRVTVTHTKGAIGQL 1006
            ..|.|.:|.:.|..::    |:......::.|         ..|.|.||.|..:|..|      |
Human   624 KPYKCNECGKVFTQNS----HLANHRRIHTGE---------KPYRCNECGKAFSVRST------L 669

  Fly  1007 QSHKFRHLPHRSFKCLTCGGEFVRKQMFFKH 1037
            .:|...|...:.:||..||..|.:.....||
Human   670 TTHMAVHTGDKPYKCNQCGKVFTQNSNLAKH 700

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6791NP_650090.1 C2H2 Zn finger 167..188 CDD:275368 3/25 (12%)
C2H2 Zn finger 208..230 CDD:275368 9/21 (43%)
C2H2 Zn finger 235..256 CDD:275368 6/20 (30%)
C2H2 Zn finger 516..532 CDD:275368 5/15 (33%)
C2H2 Zn finger 557..580 CDD:275368 8/22 (36%)
C2H2 Zn finger 589..609 CDD:275368 7/19 (37%)
COG5236 <939..>1096 CDD:227561 23/99 (23%)
ZNF665NP_001340387.1 KRAB 37..76 CDD:307490
COG5048 192..580 CDD:227381 130/660 (20%)
C2H2 Zn finger 208..228 CDD:275368 9/21 (43%)
C2H2 Zn finger 236..256 CDD:275368 6/23 (26%)
C2H2 Zn finger 264..284 CDD:275368 6/20 (30%)
C2H2 Zn finger 292..312 CDD:275368 5/20 (25%)
C2H2 Zn finger 320..340 CDD:275368 8/21 (38%)
C2H2 Zn finger 348..368 CDD:275368 5/21 (24%)
C2H2 Zn finger 376..396 CDD:275368 8/35 (23%)
C2H2 Zn finger 404..424 CDD:275368 9/32 (28%)
C2H2 Zn finger 432..452 CDD:275368 8/22 (36%)
C2H2 Zn finger 460..480 CDD:275368 7/19 (37%)
C2H2 Zn finger 488..508 CDD:275368 6/34 (18%)
C2H2 Zn finger 516..536 CDD:275368 5/20 (25%)
C2H2 Zn finger 544..564 CDD:275368 6/19 (32%)
C2H2 Zn finger 572..592 CDD:275368 7/23 (30%)
zf-H2C2_2 584..608 CDD:316026 10/87 (11%)
C2H2 Zn finger 600..620 CDD:275368 3/67 (4%)
zf-H2C2_2 612..637 CDD:316026 5/24 (21%)
C2H2 Zn finger 628..648 CDD:275368 4/23 (17%)
zf-H2C2_2 640..664 CDD:316026 7/32 (22%)
C2H2 Zn finger 656..676 CDD:275368 8/25 (32%)
zf-H2C2_2 669..693 CDD:316026 8/23 (35%)
C2H2 Zn finger 684..704 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142365
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.