DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6791 and Sry-delta

DIOPT Version :9

Sequence 1:NP_650090.1 Gene:CG6791 / 41391 FlyBaseID:FBgn0037918 Length:1243 Species:Drosophila melanogaster
Sequence 2:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster


Alignment Length:433 Identity:93/433 - (21%)
Similarity:149/433 - (34%) Gaps:163/433 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SDFEEGEAESG----VAELE----DSEQYGNGNDDFLGDTAILDSGDAIDDLLDAEEDEREEEDD 69
            |:||  ..|||    |.|:|    |.|...:...|.|....:.|..::..::.....||.|||||
  Fly    95 SEFE--VPESGEDILVEEVEIPQSDVETDADAEADALFVELVKDQEESDTEIKREFVDEEEEEDD 157

  Fly    70 YEKNSKEPKQPDPDDDALFDFNMEPIVDIAEPQRPSLAPAGPMSQ-QVRPPMQRHSFPGAGGRPR 133
                       |.||:.:.:     .||:.:    |.|..|..|. :.||..:|           
  Fly   158 -----------DDDDEFICE-----DVDVGD----SEALYGKSSDGEDRPTKKR----------- 191

  Fly   134 LGSGLSVRPTTS----------QINATDENGVPINYELGVVYICPACGGEFRQQDHWKRHMNHIH 188
                :....||.          |.:.::|:....|      :|||.||...|.:::.:.||| :|
  Fly   192 ----VKQECTTCGKVYNSWYQLQKHISEEHSKQPN------HICPICGVIRRDEEYLELHMN-LH 245

  Fly   189 K-----------------YNTLRGLNFTPLDKLYQRCRECNKRIAMHSRENLL-KHKFTH----- 230
            :                 .||||.:......|.|| |.:|..|.   |::||| .|:..|     
  Fly   246 EGKTEKQCRYCPKSFSRPVNTLRHMRMHWDKKKYQ-CEKCGLRF---SQDNLLYNHRLRHEAEEN 306

  Fly   231 --------LPFRCTK-----------------CYICKREYKYRQDLMVHLRMVHCDEVVAMMREG 270
                    :.|:..|                 |.:|.:.:..|..|.:|:: .|..:||      
  Fly   307 PIICSICNVSFKSRKTFNHHTLIHKENRPRHYCSVCPKSFTERYTLKMHMK-THEGDVV------ 364

  Fly   271 YNAAGRKTRVRESRTEQLLREKSFRENDDLGEESDRIEVRNELLEPDADESGTQEQTVSEEVSKK 335
            |.                :||::..:...:.||          |..|.|||......:..: :.:
  Fly   365 YG----------------VREEAPADEQQVVEE----------LHVDVDESEAAVTVIMSD-NDE 402

  Fly   336 KAGTRGAAELCEDYIHYMCPDCGTDCDTHAQWSQHIEFVHDYV 378
            .:|              .|..|.|:.:...:...|::|.||.|
  Fly   403 NSG--------------FCLICNTNFENKKELEHHLQFDHDVV 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6791NP_650090.1 C2H2 Zn finger 167..188 CDD:275368 8/20 (40%)
C2H2 Zn finger 208..230 CDD:275368 8/22 (36%)
C2H2 Zn finger 235..256 CDD:275368 6/37 (16%)
C2H2 Zn finger 516..532 CDD:275368
C2H2 Zn finger 557..580 CDD:275368
C2H2 Zn finger 589..609 CDD:275368
COG5236 <939..>1096 CDD:227561
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 36/166 (22%)
C2H2 Zn finger 225..245 CDD:275368 8/20 (40%)
C2H2 Zn finger 253..273 CDD:275368 4/19 (21%)
C2H2 Zn finger 281..301 CDD:275368 8/22 (36%)
C2H2 Zn finger 310..327 CDD:275370 2/16 (13%)
zf-C2H2 337..359 CDD:278523 5/22 (23%)
C2H2 Zn finger 339..359 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455506
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.