DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6791 and CG17803

DIOPT Version :9

Sequence 1:NP_650090.1 Gene:CG6791 / 41391 FlyBaseID:FBgn0037918 Length:1243 Species:Drosophila melanogaster
Sequence 2:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster


Alignment Length:539 Identity:118/539 - (21%)
Similarity:176/539 - (32%) Gaps:234/539 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EEGEAESGVAELEDSEQYGNG-------NDDFLGDT-AILDSGDAIDDL-LDAE-------EDE- 63
            ||.|:|......|:|.|...|       :.:.|.|: .:||.    ||. ||||       ||| 
  Fly   172 EEMESELENVLYEESAQQAKGVVGLEDFSSELLPDSEGVLDE----DDFPLDAEPTQFSLSEDEL 232

  Fly    64 ---REEEDDY--EKNS-----------KEPKQPDPDDD-------ALFDFN----MEPIVDIAEP 101
               |:.|.|:  |:|.           |..::....|.       .|.::|    ..|...::.|
  Fly   233 DLDRDTEKDFALEQNKSCNEIISIRKCKTKEEIGKVDHGAKVYKVVLGEYNSLKETAPKYSLSLP 297

  Fly   102 QRPSLAPAGPMSQQVRPPMQRHSFPGAGGRPRLGSGLSVRPTTSQINATDENGVPINYELGVVYI 166
            ::|.|        :|.|..:.                  |....:|.|.     |:|      |:
  Fly   298 KKPQL--------RVSPEEKN------------------RRRRERIQAK-----PLN------YV 325

  Fly   167 CPACGGEFRQQDHWKRHMNHIHKYNTLRGLNFTPLDKLYQRCRECNKRI-AMHSRENLLK--HKF 228
            |..||..|||:...:.   |:.::|  |..||        .|.||.|:. .:::|...::  ||.
  Fly   326 CDKCGHTFRQRSQLQM---HLLRHN--RAKNF--------ECPECPKKFYDLYTRNIHVRALHKG 377

  Fly   229 THLPFRCTKCYICKREYKYRQDLMVHLRMVHCDEVVAMMREGYNAAGRKTRVRESRTEQLLREKS 293
            .| ||.|.                      ||:|..|      ||:.|                 
  Fly   378 EH-PFPCN----------------------HCNESFA------NASSR----------------- 396

  Fly   294 FRENDDLGEESDRIEVRNELLEPDADESGTQEQTVSEEVSKKKAGTRGAAELCEDYIHYMCPDCG 358
            .|...|:....:||..|.:                    ||::..:|          || |..| 
  Fly   397 HRHERDVHGAGNRIRTRVK--------------------SKEEGSSR----------HY-CTQC- 429

  Fly   359 TDCDTHAQWSQHIEFVHDYVSRRGL----NFRSVDMQMQCLECK-KIVTPNTIKSLRAHKFSHLS 418
                           ...|.|::||    ||.:.....||..|: |...|:.:|   .|:..|..
  Fly   430 ---------------TKSYTSKKGLVLHMNFHNGSRPFQCKICQMKFADPSAMK---RHQALHDK 476

  Fly   419 QPEWLRCKLCYKGY------TDHQEI-----------------IRHLLQQH-----HMDTLMSED 455
            .|  :||.:|.||:      |.||::                 .|:.|.:|     |.|.:....
  Fly   477 FP--IRCDICLKGFLLRSQLTKHQDVHTGMHPHRCEICDVHYRHRYNLNKHKNTDLHRDNMQKAI 539

  Fly   456 AEEEDG--DAPSAIEDECD 472
            .||.:|  .|...|:.|.|
  Fly   540 KEEVNGLQQAFKDIDKEMD 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6791NP_650090.1 C2H2 Zn finger 167..188 CDD:275368 7/20 (35%)
C2H2 Zn finger 208..230 CDD:275368 7/24 (29%)
C2H2 Zn finger 235..256 CDD:275368 1/20 (5%)
C2H2 Zn finger 516..532 CDD:275368
C2H2 Zn finger 557..580 CDD:275368
C2H2 Zn finger 589..609 CDD:275368
COG5236 <939..>1096 CDD:227561
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871
COG5048 <323..528 CDD:227381 69/321 (21%)
zf-C2H2 324..346 CDD:278523 8/24 (33%)
C2H2 Zn finger 326..346 CDD:275368 7/22 (32%)
C2H2 Zn finger 354..375 CDD:275368 5/20 (25%)
C2H2 Zn finger 383..401 CDD:275368 9/62 (15%)
C2H2 Zn finger 426..446 CDD:275368 7/35 (20%)
C2H2 Zn finger 454..474 CDD:275368 6/22 (27%)
C2H2 Zn finger 481..501 CDD:275368 7/19 (37%)
C2H2 Zn finger 509..528 CDD:275368 3/18 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455512
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.