DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6791 and CG2678

DIOPT Version :9

Sequence 1:NP_650090.1 Gene:CG6791 / 41391 FlyBaseID:FBgn0037918 Length:1243 Species:Drosophila melanogaster
Sequence 2:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster


Alignment Length:487 Identity:106/487 - (21%)
Similarity:165/487 - (33%) Gaps:152/487 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 CRECNKR------IAMHSRENLL---KHKFTHLPFRCTKCYICKREYKYRQDLMVHLRMVHCDEV 263
            ||.|...      |..:.|:.:|   :...:|:..|||     :|..| |.||:.....|.|  |
  Fly     9 CRTCMDETGTLVDIFANVRDPVLDEPEMSLSHILARCT-----ERPVK-RGDLLPQFICVSC--V 65

  Fly   264 VAMM---------REGYN------------------AA--GRKTRV----------RESRTEQLL 289
            :|:.         .:.|.                  ||  |.|.::          |:..|:|: 
  Fly    66 LAVQNAFRFKWQSEQSYQHFFRVLNQSGAPENQVHLAACNGDKNQIINQKMQLKSDRQQDTQQM- 129

  Fly   290 REKSFRENDDLGEESDRIEVRNELLEPDAD---ESGT---QEQTVSEEVSK---KKAGTRGAAEL 345
             .|:.:.:|||   |.:..::.:|.|.:.|   ||.|   :::|...|...   .|..||....:
  Fly   130 -TKTQKPDDDL---SQKQTLQAKLQEGNIDGPPESFTLHPRKRTCRTEEQADMIPKEATRSTKMI 190

  Fly   346 CEDYIHYMCPDCGTDCDTHAQWSQHIEFVHDYVSRRGLNFRSVDMQMQCLECKKIVTPNTI---K 407
            |:...:|.||.|.....:..|...||                .|:..:|..|     |.|.   .
  Fly   191 CDADGYYNCPHCSKRFCSQTQLRTHI----------------TDLCNRCPYC-----PRTYMQKS 234

  Fly   408 SLRAHKFSHLSQPEWLRCKLCYKGYTDHQEIIRHLLQQHHMDTLMS--------------EDAEE 458
            :|:.|..:|||:|.. :|..|.|.:.....:.|| |:.|..|..:|              |....
  Fly   235 NLKRHLRNHLSKPAH-KCFHCSKAFMRKDHLKRH-LRTHDSDGPLSCSQCSAVFIEHVQLEIHRR 297

  Fly   459 EDGDAPSAIEDECDGDNGNGEGNGAPLDEDSPYFEDAPRR------GGRISSDDIFEPHIDYLCP 517
            |....|.:.:.|...|         |..:||...:|...:      .|..|...:.:|  ..:|.
  Fly   298 EHKQRPGSSKSESTKD---------PDSDDSDQAQDLKPKWTKNTFNGTCSIPPMLKP--KPICD 351

  Fly   518 QCGKEFIE----KKHWRTHVVMAHSMNDLSKLNFEMINERQLKCTECDKIITNAYGIQNAQQHRI 578
            .|.|:|..    |:|..||....|..                |||.|.:.....   ::.::|..
  Fly   352 ICQKKFSSVYALKRHMLTHNRQHHLK----------------KCTYCSEEFKTE---KHLKRHER 397

  Fly   579 THLPFKAYARCRKCHKSYTDRKGLVKHLATHH 610
            .|:  ....||..|...:.|...|.||....|
  Fly   398 GHM--GDLFRCEFCSLVFVDVNYLRKHKKRIH 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6791NP_650090.1 C2H2 Zn finger 167..188 CDD:275368
C2H2 Zn finger 208..230 CDD:275368 6/30 (20%)
C2H2 Zn finger 235..256 CDD:275368 7/20 (35%)
C2H2 Zn finger 516..532 CDD:275368 6/19 (32%)
C2H2 Zn finger 557..580 CDD:275368 4/22 (18%)
C2H2 Zn finger 589..609 CDD:275368 6/19 (32%)
COG5236 <939..>1096 CDD:227561
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 20/83 (24%)
COG5048 220..>284 CDD:227381 19/70 (27%)
C2H2 Zn finger 223..243 CDD:275368 6/24 (25%)
zf-C2H2 249..271 CDD:278523 6/23 (26%)
C2H2 Zn finger 251..271 CDD:275368 6/20 (30%)
C2H2 Zn finger 279..299 CDD:275368 1/19 (5%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
C2H2 Zn finger 379..399 CDD:275368 4/22 (18%)
C2H2 Zn finger 406..427 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.