DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6791 and CG12942

DIOPT Version :9

Sequence 1:NP_650090.1 Gene:CG6791 / 41391 FlyBaseID:FBgn0037918 Length:1243 Species:Drosophila melanogaster
Sequence 2:NP_610628.2 Gene:CG12942 / 36158 FlyBaseID:FBgn0033569 Length:686 Species:Drosophila melanogaster


Alignment Length:767 Identity:140/767 - (18%)
Similarity:249/767 - (32%) Gaps:223/767 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   512 IDYLCPQCGKEFIEKKHWRTHVVMAHSMNDLSKLNFEMIN------ERQLKCTECDKIITNA-YG 569
            :|....|...|....:..||:   |.|:...:.|:..:|:      ..|: |..|.:.:..| :.
  Fly    28 VDRKTVQLNAEVPNLQKTRTY---AQSLKQCTNLDLRVISPGGYLWPMQI-CVRCCRALEVAMHF 88

  Fly   570 IQNAQQHRITHLPFKAYARCRKCHKSYTDRKGLVKHLATHHRVGWPR------KLSGGCPAPI-- 626
            ::.|.:   ::|..:|.|:..|    .....|.:|..|::..:.|.:      :...|...||  
  Fly    89 VEMALE---SNLKLQAEAKSVK----LPSPTGELKRKASNETIPWNQFSQEFEQFVEGYEGPIEE 146

  Fly   627 ----LTPAKQPRKQI-VTVANETY----EIIYLD------DVDQGGMEEDNDFGEQMQAEED--E 674
                :...|.||..: .:.::||.    |:|..|      |::    |||.:.|...:..|.  |
  Fly   147 NVLYMRGTKVPRLDVDASSSSETAPKEDEVILFDVKYDTNDLE----EEDENDGSDAKNNETFFE 207

  Fly   675 YPIAPPPPSPPPPPQPTTQGNHQRYKC---------VHCGTLFATQAAVRVHISEKRCR---KTV 727
            ..|.|...............|:..|..         ..|..:   |.|:.:.:::..|.   |..
  Fly   208 NSITPGESVMVVSVAEKAVENNNNYNFNNKNGDVTDEECDLI---QRALEMTLNDDGCSQSPKNE 269

  Fly   728 VRRRRQPVMSSADPSVP----------TVEQNYIFLCPSCGFEYKTQFEWRRHINEVHNFDKRQ- 781
            .....|...:..:.|.|          |.....|..|..|.:.:....:.:.|...:|.....: 
  Fly   270 ASNETQLKSNGIEVSSPLFIKLATTSSTTGNIPILKCNICQYTHTDAEQLKIHYKSIHKISMMED 334

  Fly   782 ---YLNMRQLDKYRYQCTQCKDIVCNSK---LKGLQDHHFRHLPYRLY----LKCLICGTCYNHK 836
               .||..|    .::|..|.......:   .|.|.|||.....:.:|    ..|..|...:..:
  Fly   335 DIIGLNKNQ----NFKCRPCNSYETKDRSEMQKHLIDHHKIDGDFEMYCYMQANCPACDRIFKDQ 395

  Fly   837 PNIAAHLRARHSIFDRETPTMITKPKQVLGRYKDNSRENPKLPSPPPAPALAPAPPSPPACSSSA 901
            .:...|....|      ||..|                             |.:|....||::..
  Fly   396 RSARKHYTRVH------TPVQI-----------------------------AVSPTESYACTACD 425

  Fly   902 AASASSRSLKPQPGGLPARPAGLNTLEDSISYHNAVDLDFITYFCPKCNQNFDSHAFWRKHIVEQ 966
            .......||.                    |:.....:..:.: |..|:|.|:|...:..|:.:.
  Fly   426 KVFNQKASLH--------------------SHQRFCQVKDVVH-CSFCDQQFNSMRKYELHLQQL 469

  Fly   967 HNFNSREGLNFRQIDNHHYLCLECYKRVTVTHTKGAIGQLQSHKFRHLPHRSFKCLTCGGEFVRK 1031
            |           .::..|. |..|.:......|      |..|:.|| ..|.::|..|...:|  
  Fly   470 H-----------AVETVHE-CEICRRSFKSAET------LTMHRKRH-SERHYQCGKCSLNYV-- 513

  Fly  1032 QMFFKHLNRDTNRCDNRPH--REFDDDEPDQDTLLSTIYHLTCPQCGDNFKTHNKKEWREHINDH 1094
                       |..:.|.|  |...::||           ::|..||:.|:  |....|||....
  Fly   514 -----------NSAELRVHYERAHVNEEP-----------VSCLTCGNQFQ--NMTLLREHEQRS 554

  Fly  1095 HGLTKLELLHMTKVGEDVYRCQDCDEELETNRQWVLQFHRFQHLPHAAYIRCKLCKQSSADGADA 1159
            |..:|            |:||:.|:  .||..:|..:.|:::|:.:.  .:|:.|....||.:  
  Fly   555 HQKSK------------VWRCEVCN--FETKTRWRRRQHQYEHMDYP--YKCQKCTSEFADRS-- 601

  Fly  1160 VGELHSLRELQQHIRKHHPGLGDAEMISLIEQIIQDEKEQEEGTEQTNDGEN 1211
                    :.:||.:|.|.       |.|.::.:.:...:::|....:|..|
  Fly   602 --------KFRQHSKKVHG-------IELSDEQLAEMFREKKGYTNRHDAFN 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6791NP_650090.1 C2H2 Zn finger 167..188 CDD:275368
C2H2 Zn finger 208..230 CDD:275368
C2H2 Zn finger 235..256 CDD:275368
C2H2 Zn finger 516..532 CDD:275368 3/15 (20%)
C2H2 Zn finger 557..580 CDD:275368 4/23 (17%)
C2H2 Zn finger 589..609 CDD:275368 4/19 (21%)
COG5236 <939..>1096 CDD:227561 33/158 (21%)
CG12942NP_610628.2 zf-AD 22..101 CDD:285071 15/79 (19%)
C2H2 Zn finger 385..406 CDD:275368 3/20 (15%)
C2H2 Zn finger 421..470 CDD:275368 10/69 (14%)
C2H2 Zn finger 449..466 CDD:275371 5/16 (31%)
C2H2 Zn finger 478..498 CDD:275368 5/25 (20%)
C2H2 Zn finger 505..526 CDD:275368 7/33 (21%)
C2H2 Zn finger 534..555 CDD:275368 8/22 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440072
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.