DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6791 and az2

DIOPT Version :9

Sequence 1:NP_650090.1 Gene:CG6791 / 41391 FlyBaseID:FBgn0037918 Length:1243 Species:Drosophila melanogaster
Sequence 2:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster


Alignment Length:717 Identity:132/717 - (18%)
Similarity:232/717 - (32%) Gaps:240/717 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 LLKHKFTHLPFRC---TKCYICKREYKYRQDLMVHLRMVHCD------------EVVAMMREGYN 272
            |.::.|.|....|   ..||: :.|:|..::.:||:: .|.:            ||::..:....
  Fly     8 LARNNFEHFVLACAHQNDCYV-EMEFKRWREFIVHVK-EHLEANPSMQQELTTSEVISSAKCEEE 70

  Fly   273 AAGRKTRVRESRTEQLLREKSF------RENDDLGEESDRIEVRNELLEPDADESGTQEQTVSEE 331
            .:..|..:.|...|..|.|..|      .|||   |.:..:|...|    :.||..:...||..|
  Fly    71 VSPAKVFIVEEPPENCLAEDMFVDVPPSSEND---ESTSPVEEEEE----EDDEVDSSSMTVDCE 128

  Fly   332 VSKKKAGTRGA--------------------AELCEDYIHYMCPDCGTDCDTHAQWSQHIEFVHD 376
            :     |||.:                    .:..|.|....|           .|....|...|
  Fly   129 L-----GTRNSTHFAPLTKFNPTFYRRSPRITQFIELYKQQTC-----------LWDPADESYRD 177

  Fly   377 YVSRRGLNFR-------SVDMQMQCLECKKIVTPNTIKSLRAHKFSHLSQPEWLRCKLCYKGYTD 434
            ...|......       :|::.:...:.||.:|     ||.| :::.:|:.:            .
  Fly   178 KEKRANAYEELLEQLKATVNLHLTAYKLKKCIT-----SLHA-QYASISRQK------------K 224

  Fly   435 HQEIIRHLLQQHHMDTLMSEDAEEEDGDAPSAIEDECDGDNGNGEGNGAPLDEDS---------- 489
            .|::.:..|..|...:.::|....||.|:     |:.|||   |:......:|:.          
  Fly   225 TQKLTKVPLYYHGKYSFLAERGSLEDADS-----DDVDGD---GKIKLVFTEENQLTTQFIDLYS 281

  Fly   490 --PYFEDAP---------RRGGRISSDDIFE--------PHID-YLCPQCGKEFIEKKHWRTHVV 534
              |...|..         |:...|...|:..        .|.| |...|..:::..::......|
  Fly   282 KFPQLYDPAHKHFCNLNVRKSSLIEITDLLTSEFSLGLVTHYDVYDSIQSMRQWYSRRIKTLTDV 346

  Fly   535 MAHSMNDLSKLNFEMIN--------ERQLKCTECDKIITNAYGIQNAQQHRITHLPFKAYARCRK 591
            ....::...|...|..|        .::|||..|:...:..:.:| |.|.|...:....:.||..
  Fly   347 QCVGLSLAEKQYIERCNSFMPTKSFRQKLKCEVCEHSFSTDHALQ-AHQFRDHKMGDGGWFRCTL 410

  Fly   592 CHKSYTDRKGLVKHLATH-HRVGWPRKLSGGCPAPILTPAKQPRKQIVTVANETYEIIYLDDVDQ 655
            |..:: |||   .||..| .||...:..                  :..:.:.::.         
  Fly   411 CELNF-DRK---CHLQQHSQRVHMDKSF------------------VCEICSRSFA--------- 444

  Fly   656 GGMEEDNDFGEQM---QAEEDEYPIAPPPPSPPPPPQPTTQGNHQRYKCVHCGTLFATQAAVRVH 717
                    ||.|:   :...||..:|.|                  :.|..||..|..:..:..|
  Fly   445 --------FGNQLAIHKRTHDEKHVAKP------------------FVCEFCGKCFKQKIQMTTH 483

  Fly   718 ISEKRCRKTVVRRRRQPVMSSADPSVPTVEQNYIFLCPSCGFEYKTQFEWRRHINEVHNFDKRQY 782
            ::...   |.:|                     .|.|..|..::.|:.:.:.|:        :.:
  Fly   484 VTAVH---TKIR---------------------AFKCDMCPKDFLTKRDLKDHV--------KAH 516

  Fly   783 LNMRQLDKYRYQCTQCKDIVCNSKLKGLQDHHFRHLPYRLYLKCLICGTCYNHKPNIAAHLRARH 847
            ||:|  ||.   |..|:....|:  ..|..|  ||:.....|:|.:|.|.::.:.::..|:|..|
  Fly   517 LNIR--DKV---CEVCQKAFTNA--NALVKH--RHIHKEKTLQCSLCTTRFSERVSLGVHMRRTH 572

  Fly   848 SI 849
            .|
  Fly   573 KI 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6791NP_650090.1 C2H2 Zn finger 167..188 CDD:275368
C2H2 Zn finger 208..230 CDD:275368 2/6 (33%)
C2H2 Zn finger 235..256 CDD:275368 7/23 (30%)
C2H2 Zn finger 516..532 CDD:275368 1/15 (7%)
C2H2 Zn finger 557..580 CDD:275368 6/22 (27%)
C2H2 Zn finger 589..609 CDD:275368 7/19 (37%)
COG5236 <939..>1096 CDD:227561
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510 18/113 (16%)
GT1 276..>341 CDD:304916 9/64 (14%)
C2H2 Zn finger 377..398 CDD:275368 6/21 (29%)
C2H2 Zn finger 408..429 CDD:275368 9/24 (38%)
C2H2 Zn finger 436..456 CDD:275368 3/36 (8%)
C2H2 Zn finger 467..488 CDD:275368 5/20 (25%)
C2H2 Zn finger 496..516 CDD:275368 4/27 (15%)
C2H2 Zn finger 524..544 CDD:275368 7/23 (30%)
C2H2 Zn finger 551..572 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440043
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.