DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6791 and CG30431

DIOPT Version :9

Sequence 1:NP_650090.1 Gene:CG6791 / 41391 FlyBaseID:FBgn0037918 Length:1243 Species:Drosophila melanogaster
Sequence 2:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster


Alignment Length:458 Identity:93/458 - (20%)
Similarity:138/458 - (30%) Gaps:172/458 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   800 DIVCNSKLKGLQD-------------------HHFRH-------LPYRLYLKCL----------I 828
            |::|:..|:.|.|                   .|::|       |.....|:||          :
  Fly    54 DVICDLCLRRLHDARDFQRRCEHSEQVLRMRHEHWKHTVAVGDALALDDVLECLEREVGSLEGPM 118

  Fly   829 CGTCYNHKPNIAAHLRARHSIFDRETPTMITKPKQVLGRYKDNSRENPKLPS------------- 880
            .......||  .||:          .|.|.|...:.|. ::|:|.....:||             
  Fly   119 SVPLQASKP--VAHV----------APLMETVDFESLD-FQDSSHSEHDIPSYWESSVDSGSLNT 170

  Fly   881 ----PPPAPALAPAPPSPPACSSSAAASASSRSLKPQPGGLPARPAGLNTLEDSISYHNAVDLDF 941
                |..|...|..||:||..|...|..|:.:     |....|||...|..........||....
  Fly   171 PHHQPETAELFAVEPPTPPESSEEPAPDAAEK-----PKMRRARPRQDNVKPKERKASGAVHPRS 230

  Fly   942 ITYFCPKCNQNFDSHAFWRKHIVEQHNFNSREGLNFRQIDNHHYLCLECYKRVTVTHTKGAIGQL 1006
            : :.||:|.:.|..:...:.|:...|.....           .|.|.||.|.....|:      |
  Fly   231 L-HPCPECEKKFTRNFQLKLHMTAVHGMGEM-----------RYQCEECRKNFASRHS------L 277

  Fly  1007 QSH-KFRHLPHRSFKCLTCGGEFVRKQMFFKHLNRDT----------NRC--------DNRPHRE 1052
            :.| |..|...|.|.|..|...|:.:.....||...|          .||        |.|.|..
  Fly   278 RYHVKSVHSTERPFGCQHCDRRFILRTQLLSHLRTHTGEAKPRIFECQRCSKSWPTKSDLRTHMR 342

  Fly  1053 FDDDEPDQDTLLSTIYHLTCPQCGDNFKTHNKKEWREHINDHHGLTKLELLHMTKVGEDVYRCQD 1117
            ..:...::.        ..|.:|...|.|      |.|:|.|      .|:|   .||..:.|:.
  Fly   343 SHNPNMERP--------FKCDRCSKAFFT------RGHLNSH------LLVH---TGEKPFACEY 384

  Fly  1118 CDEELETNRQWVLQFHRFQHLPHAAYIRCKLCKQSSADGADAVGELHSLRELQQHIRKHHPGLGD 1182
            ||:                            |.||       ||.|::      |:.:.|..:.:
  Fly   385 CDK----------------------------CYQS-------VGNLNN------HMVRLHADIIE 408

  Fly  1183 AEM 1185
            |::
  Fly   409 AQL 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6791NP_650090.1 C2H2 Zn finger 167..188 CDD:275368
C2H2 Zn finger 208..230 CDD:275368
C2H2 Zn finger 235..256 CDD:275368
C2H2 Zn finger 516..532 CDD:275368
C2H2 Zn finger 557..580 CDD:275368
C2H2 Zn finger 589..609 CDD:275368
COG5236 <939..>1096 CDD:227561 37/175 (21%)
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 5/27 (19%)
C2H2 Zn finger 234..255 CDD:275368 5/20 (25%)
C2H2 Zn finger 264..285 CDD:275368 8/26 (31%)
C2H2 Zn finger 293..313 CDD:275368 5/19 (26%)
zf-C2H2_8 305..373 CDD:292531 16/87 (18%)
C2H2 Zn finger 324..344 CDD:275368 5/19 (26%)
C2H2 Zn finger 354..374 CDD:275368 9/31 (29%)
zf-H2C2_2 366..389 CDD:290200 10/59 (17%)
C2H2 Zn finger 382..403 CDD:275368 10/61 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.