DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6791 and wor

DIOPT Version :9

Sequence 1:NP_650090.1 Gene:CG6791 / 41391 FlyBaseID:FBgn0037918 Length:1243 Species:Drosophila melanogaster
Sequence 2:NP_476601.1 Gene:wor / 34906 FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster


Alignment Length:666 Identity:126/666 - (18%)
Similarity:190/666 - (28%) Gaps:279/666 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 AELEDSEQY--GNGNDDFLGDTAILDSGDAIDDLLDAEEDEREEEDDYE-KNSKEPKQPDPDDDA 86
            ||..|.||:  .|.|::.|...|                   |.||..: :|.||...|.|....
  Fly   149 AEPSDEEQFPLRNYNNNLLKSIA-------------------EYEDCMKMQNIKEEIPPIPSPQL 194

  Fly    87 LFDFNMEPIVDIAEPQRPSLAPAGPMSQQVRPPMQRHSFPGAGGRPRLGSGLSVRPTTSQINATD 151
            .:    .|...:|||:..|:.....:|:.:.  :|..:      |..|         :.|..|..
  Fly   195 FY----PPPTPLAEPEDLSVTQRRVLSENMN--LQNVA------RALL---------SMQHMAPQ 238

  Fly   152 ENGVPINYELGVVYICPACGGEFRQQDHWKRHMNHIHKYNTLRGLNFTPLDKLYQRCRECNKRIA 216
            ....||:.|                :|...:.:|.         |.....:.||.:|::|||..|
  Fly   239 HAPPPIDME----------------EDQENQDINQ---------LKIKSSNDLYYQCQQCNKCYA 278

  Fly   217 MHSRENLLKHKFTHLPFRCTKCYICKREYKYRQDLMVHLRMVHCDEVVAMMREGYNAAGRKTRVR 281
            .::  .|:||:.|| .:..|       |||                   ::|.....:|......
  Fly   279 TYA--GLVKHQQTH-AYEST-------EYK-------------------IIRSQPGGSGAIVDQT 314

  Fly   282 ESRTEQLLREKSFRENDDLGEESDRIEVRNELLEPDADESGTQEQTVSEEVSKKKAGTRGAAELC 346
            |..|:|               .|..|:..|               ..|.:..:|..|..      
  Fly   315 EFCTDQ---------------ASALIQAAN---------------VASAQSMQKPVGVP------ 343

  Fly   347 EDYIHYMCPDCGTDCDTHAQWSQHIEFVHDYVSRRGLNFRSVDMQMQCLECKKIVTPNTIKSLRA 411
                .|.|.|||....|::..|:|.:|  ...|..|...:.|   ..|..|.|  |..::.:|:.
  Fly   344 ----RYHCQDCGKSYSTYSGLSKHQQF--HCPSAEGNQVKKV---FSCKNCDK--TYVSLGALKM 397

  Fly   412 HKFSHLSQPEWLRCKLCYKGYTDHQEIIRHLLQQHHMDTLMSEDAEEEDGDAPSAIEDECDGDNG 476
            |..:|.     |.||                                                  
  Fly   398 HIRTHT-----LPCK-------------------------------------------------- 407

  Fly   477 NGEGNGAPLDEDSPYFEDAPRRGGRISSDDIFEPHIDYLCPQCGKEF----IEKKHWRTHVVMAH 537
                                                   ||.|||.|    :.:.|.|||.    
  Fly   408 ---------------------------------------CPICGKAFSRPWLLQGHIRTHT---- 429

  Fly   538 SMNDLSKLNFEMINERQLKCTECDKIITNAYGIQNAQQHRITHLPFKAYARCRKCHKSYTDRKGL 602
                         .|:...|..|::...:.   .|.:.|..||...|.|: |..|.||::....|
  Fly   430 -------------GEKPFSCQHCNRAFADR---SNLRAHMQTHSDVKKYS-CPTCTKSFSRMSLL 477

  Fly   603 VKHLAT---HHRVGWPRKLSGGCPAPILTPAKQPRKQIVTVANETYEIIYLDDVDQGGMEEDNDF 664
            .|||.:   ..:.|.|....||.....|    |...|:....:..:::.|...|.....||:   
  Fly   478 AKHLQSGCQTEQSGGPSGSGGGFDQQQL----QQHLQVYEEGHNPHQLYYAGSVGSSNGEEE--- 535

  Fly   665 GEQMQAEEDEYPIAPP 680
                  |..||.:.||
  Fly   536 ------EGGEYQMQPP 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6791NP_650090.1 C2H2 Zn finger 167..188 CDD:275368 2/20 (10%)
C2H2 Zn finger 208..230 CDD:275368 8/21 (38%)
C2H2 Zn finger 235..256 CDD:275368 4/20 (20%)
C2H2 Zn finger 516..532 CDD:275368 8/19 (42%)
C2H2 Zn finger 557..580 CDD:275368 4/22 (18%)
C2H2 Zn finger 589..609 CDD:275368 8/22 (36%)
COG5236 <939..>1096 CDD:227561
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368 8/21 (38%)
C2H2 Zn finger 317..334 CDD:275368 6/46 (13%)
zf-C2H2 345..367 CDD:278523 9/23 (39%)
C2H2 Zn finger 347..367 CDD:275368 8/21 (38%)
PHA00732 379..>417 CDD:177300 17/136 (13%)
C2H2 Zn finger 382..402 CDD:275368 6/21 (29%)
zf-C2H2_8 405..482 CDD:292531 28/186 (15%)
zf-C2H2 406..428 CDD:278523 10/110 (9%)
C2H2 Zn finger 408..428 CDD:275368 8/19 (42%)
zf-H2C2_2 421..444 CDD:290200 7/39 (18%)
zf-C2H2 434..456 CDD:278523 4/24 (17%)
C2H2 Zn finger 436..456 CDD:275368 4/22 (18%)
zf-H2C2_2 448..473 CDD:290200 10/25 (40%)
C2H2 Zn finger 464..481 CDD:275368 6/16 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.