DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6791 and CG12299

DIOPT Version :9

Sequence 1:NP_650090.1 Gene:CG6791 / 41391 FlyBaseID:FBgn0037918 Length:1243 Species:Drosophila melanogaster
Sequence 2:NP_609448.1 Gene:CG12299 / 34483 FlyBaseID:FBgn0032295 Length:736 Species:Drosophila melanogaster


Alignment Length:922 Identity:146/922 - (15%)
Similarity:250/922 - (27%) Gaps:397/922 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SDFEEGEAESGVAELEDSEQYGNGNDDFLGDTAILDSGDAIDDLLDAEEDEREEEDDYEKNSKEP 77
            ||..:|.|.||    .||....:.:||...|.:...|..:.:....:.........:.:: |:|.
  Fly   107 SDSSDGSASSG----SDSSSSSDDDDDDDDDDSSSSSSSSSNSSSSSSSVPTTSNSNTQQ-SQES 166

  Fly    78 KQP------------------DPDDDALFDFNMEPIVDIAEPQRPSLAPAGPMSQQVRPPMQRHS 124
            .||                  ||.:.... |.::|.|.:.           |: ||:.||....|
  Fly   167 VQPLHGLVAGPGYNEFQLQMTDPRESTSI-FMVQPTVSVT-----------PL-QQLLPPAPTVS 218

  Fly   125 FPGAGGRPRLGSGLSVRPTTSQINATDENGVPI-------NYELGVVYICPACGGEFRQQDHWKR 182
             ||.        ||...|...:.......|.|:       |.:   .:.|..|...|.......:
  Fly   219 -PGL--------GLQSTPIKRRRGRRSNIGAPVMDPALNGNQK---CFQCTHCEASFPNAGDLSK 271

  Fly   183 HM-NHIHKYNTLRGLNFTPLDKLYQRCRECNKRIAMHSRENLLKHKFTHLPFRCTKCYICKREYK 246
            |: :||    |.:....:...|.:......|..|.:||.|.         |:   ||.:|.:.:.
  Fly   272 HVRSHI----TNKPFQCSICQKTFTHIGSLNTHIRIHSGEK---------PY---KCELCPKAFT 320

  Fly   247 YRQDLMVHLR---------MVHCDEVVAMMREGYNAAGRKTRVRESRTEQLLREKSFRENDDLGE 302
            ....||||:|         .|.||:  ..:........:||.:..:.|                 
  Fly   321 QSSSLMVHMRSHSVRKPHQCVQCDK--GFINYSSLLLHQKTHIAPTET----------------- 366

  Fly   303 ESDRIEVRNELLEPDADESGTQEQTVSEEVSKKKAGTRGAAELCEDYIHYMCPDCGTDCDTHAQW 367
                                                             ::||:|..:....|..
  Fly   367 -------------------------------------------------FICPECEREFKAEALL 382

  Fly   368 SQHIEFVHDYVSRRGLNFRSVDMQMQCLECKKIVTPNTIKSLRAHKFSHLSQPEWLRCKLCYKGY 432
            .:|                                      :|.|     :|....:|.:|.:.:
  Fly   383 DEH--------------------------------------MRMH-----TQELVYQCAICREAF 404

  Fly   433 TDHQEIIRHLLQQHHMDTLMSEDAEEEDGDAPSAIEDECDGDNGNGEGNGAPLDEDSPYFEDAPR 497
            ....|:::|:  ::||            |:.|                                 
  Fly   405 RASSELVQHM--KNHM------------GEKP--------------------------------- 422

  Fly   498 RGGRISSDDIFEPHIDYLCPQCGKEFIEKK----HWRTHVVMAHSMNDLSKLNFEMINERQLKCT 558
                            :.|..|.:.|.:..    |.|.|.                 .|:..:|.
  Fly   423 ----------------FTCSLCDRSFTQSGSLNIHMRIHT-----------------GEKPFQCK 454

  Fly   559 ECDKIITNAYGIQNAQQHRITHLPFKAYARCRKCHKSYTDRKGLVKHLATHHRVGWPRKLSGGCP 623
            .|||..|.|   .:...|...|...|.|. |..|.|||:.:..|.||:..|...    ..:....
  Fly   455 LCDKCFTQA---SSLSVHMKIHAGEKPYP-CPICGKSYSQQAYLNKHIQAHQMA----SAASAST 511

  Fly   624 APILTPAKQPRKQIVTVANETYEIIYLDDVDQGGMEEDNDFGEQMQAEEDEYPIAPPPPSPPPPP 688
            :|.|..||||                                                       
  Fly   512 SPGLLVAKQP------------------------------------------------------- 521

  Fly   689 QPTTQGNHQRYKCVHCGTLFATQAAVRVHISEKRCRKTVVRRRRQPVMSSA-DPSVPTVEQNYIF 752
                   |:...|:.||:|.|...|:..|:..:..  .::...:|..|::| ..::|.|:     
  Fly   522 -------HETLVCIVCGSLHADATALASHVHSQHA--ALLDTMKQSGMNTAPGGAIPDVK----- 572

  Fly   753 LCPSCGFEYKTQFEWRRHINEVH------NFDKRQYLNMRQLDKYRYQCTQCKDIVCNSKLKGLQ 811
                |..|     |.:.::..|.      |..::...:.:|..:.:.|..|.:           |
  Fly   573 ----CSAE-----EQQAYVERVQCVLQQMNHQQQHQQHQQQPPQQQQQHPQQQ-----------Q 617

  Fly   812 DHHFRHLPYRLYLKCLICGTCYNHKPNIAAHLRARHSIFDRETPTMITKPKQVLGRYKDNSRENP 876
            ..|.:..|:::.|.         .:|.:.|......   |.|.|....:|..     ::..::.|
  Fly   618 QQHLQQQPHQMQLP---------QQPKLPAMDSTGE---DEEEPDEAEEPPD-----EEEEQDEP 665

  Fly   877 KLPSPPPAPALA 888
            :.|:......||
  Fly   666 EEPAEVKTEVLA 677

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6791NP_650090.1 C2H2 Zn finger 167..188 CDD:275368 5/21 (24%)
C2H2 Zn finger 208..230 CDD:275368 5/21 (24%)
C2H2 Zn finger 235..256 CDD:275368 7/20 (35%)
C2H2 Zn finger 516..532 CDD:275368 5/19 (26%)
C2H2 Zn finger 557..580 CDD:275368 7/22 (32%)
C2H2 Zn finger 589..609 CDD:275368 8/19 (42%)
COG5236 <939..>1096 CDD:227561
CG12299NP_609448.1 COG5048 <254..413 CDD:227381 39/285 (14%)
C2H2 Zn finger 256..276 CDD:275368 4/19 (21%)
zf-H2C2_2 268..293 CDD:290200 5/28 (18%)
C2H2 Zn finger 284..304 CDD:275368 3/19 (16%)
zf-H2C2_2 296..321 CDD:290200 9/36 (25%)
zf-C2H2_2 312..>387 CDD:289522 18/180 (10%)
C2H2 Zn finger 312..332 CDD:275368 7/19 (37%)
C2H2 Zn finger 340..360 CDD:275368 4/21 (19%)
C2H2 Zn finger 369..389 CDD:275368 6/57 (11%)
C2H2 Zn finger 397..417 CDD:275368 4/21 (19%)
zf-H2C2_2 409..434 CDD:290200 9/87 (10%)
C2H2 Zn finger 425..445 CDD:275368 5/19 (26%)
zf-H2C2_2 437..462 CDD:290200 8/41 (20%)
C2H2 Zn finger 453..473 CDD:275368 7/22 (32%)
zf-H2C2_2 465..490 CDD:290200 9/25 (36%)
C2H2 Zn finger 481..501 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.