DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6791 and CG7101

DIOPT Version :9

Sequence 1:NP_650090.1 Gene:CG6791 / 41391 FlyBaseID:FBgn0037918 Length:1243 Species:Drosophila melanogaster
Sequence 2:NP_573329.2 Gene:CG7101 / 32875 FlyBaseID:FBgn0030963 Length:352 Species:Drosophila melanogaster


Alignment Length:550 Identity:102/550 - (18%)
Similarity:149/550 - (27%) Gaps:251/550 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   680 PPPSPPPPPQPTTQG-------NHQRYKCVHCGTLFA---TQAAVRVHISEKRCRKTVVRRRRQP 734
            |.|..|..|..:.:|       ...:.:..|||..||   ...|.:.|  |::|.   ||.||  
  Fly     3 PVPIRPKAPGASNRGALPLAAKKPAKKRTYHCGVCFAEFSRHLAAKRH--EQQCS---VRVRR-- 60

  Fly   735 VMSSADPSVPTVEQNYIFLCPSCGFEYKTQFEWRRHINEVHNFDKRQYLNMRQLDKYRYQCTQCK 799
                            :|:||.|...:..:....||....||  ..|:|                
  Fly    61 ----------------LFVCPHCLTLFGEEARLERHRERKHN--DGQFL---------------- 91

  Fly   800 DIVCNSKLKGLQDHHFRHLPYRLYLKCLICGTCYNHKPNIAAHLRARH---SIFDRETPTMITKP 861
                                      ||.||..|.....:..|:.:.|   |:|           
  Fly    92 --------------------------CLQCGKKYASATFLYRHVASWHGQQSLF----------- 119

  Fly   862 KQVLGRYKDNSRENPKLPSPPPAPALAPAPPSPPACSSSAAASA------------SSRSLKPQP 914
                  |.|...:|                     |:.....|.            ..|:||...
  Fly   120 ------YCDMCTDN---------------------CNDVKTFSGMLELQEHAEEVHRLRTLKSTA 157

  Fly   915 GGLPARPAGLNTLE----------------DSISYHNAVDLDF---------ITYFCPKCNQNFD 954
            ....::...:..||                |.:::....|||.         ..:.||.|...|.
  Fly   158 SDADSQVDEMEDLEMLEENIENILPSIDWDDDLTFGWPTDLDKESCIVNAKPSVFVCPFCANGFP 222

  Fly   955 SHAFWRKHIVEQHNFNSREGLNFRQIDNHHYLCLECYKRVTVTHTKGAIGQLQSHKFR-HLPHRS 1018
            ......:|:.:.|   .|..|:          |..|.|      :.|:...|:||..| |:..|.
  Fly   223 GSLSLVRHLEQVH---ERSALD----------CCYCGK------SHGSREALRSHLQRVHILLRG 268

  Fly  1019 FKCLTCGGEFVRKQMFFKHLNRDTNRCDNRPHREFDDDEPDQDTLLSTIYHLTCPQCGDNFKTHN 1083
            ..|..|..:|.......||:|  :...|:|||                    .||.||..|..  
  Fly   269 HVCGICQADFATADHLKKHVN--SLHLDHRPH--------------------LCPTCGKRFTQ-- 309

  Fly  1084 KKEWREHINDHHGLTKLELLHMTKVGEDVYRCQDCDEELETNRQWVLQFHRFQHLPHAAYIRCKL 1148
                |.|:.||   .|.:..|    |...|.|:.|          |..|.|              
  Fly   310 ----RCHLTDH---IKTDRGH----GHGTYTCEFC----------VRPFFR-------------- 339

  Fly  1149 CKQSSADGADAVGELHSLRELQQHIRKHHP 1178
                      |:       :|::|:.:.||
  Fly   340 ----------AI-------DLERHVCEEHP 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6791NP_650090.1 C2H2 Zn finger 167..188 CDD:275368
C2H2 Zn finger 208..230 CDD:275368
C2H2 Zn finger 235..256 CDD:275368
C2H2 Zn finger 516..532 CDD:275368
C2H2 Zn finger 557..580 CDD:275368
C2H2 Zn finger 589..609 CDD:275368
COG5236 <939..>1096 CDD:227561 39/166 (23%)
CG7101NP_573329.2 PHA00733 <210..263 CDD:177301 16/71 (23%)
C2H2 Zn finger 242..263 CDD:275368 8/26 (31%)
C2H2 Zn finger 271..292 CDD:275368 6/22 (27%)
C2H2 Zn finger 300..319 CDD:275368 9/27 (33%)
C2H2 Zn finger 330..347 CDD:275368 7/57 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455440
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.