DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6791 and CG8944

DIOPT Version :9

Sequence 1:NP_650090.1 Gene:CG6791 / 41391 FlyBaseID:FBgn0037918 Length:1243 Species:Drosophila melanogaster
Sequence 2:NP_573065.1 Gene:CG8944 / 32517 FlyBaseID:FBgn0030680 Length:762 Species:Drosophila melanogaster


Alignment Length:768 Identity:146/768 - (19%)
Similarity:234/768 - (30%) Gaps:297/768 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ELEDSEQYGNGNDDFLGDTAILDSGDAI-----------DDLLDAEEDEREEE-DDYEKNSKEPK 78
            |:||...         .|||:|:....|           ||::..|||:.|:. :|.|.:..|..
  Fly    94 EIEDLTD---------ADTALLEPQMVIKQELQDLPCSDDDVVAGEEDDDEQRLNDSEADEDEAI 149

  Fly    79 QPDPDDDALFDFNMEPIVDIAEPQRPSLAPAGPMSQQVRPPMQRHSFPGAGGRPRLGSGLSVRPT 143
            .|:.|         .|:|......|..:.     .|:.|.........|.|.             
  Fly   150 LPESD---------VPVVSSKTRARKKVT-----KQRQRDMSSELLIAGDGD------------- 187

  Fly   144 TSQINATDENGVPINYELGVVYICPACGGEFRQQDHWKRHMNHIHKYNTLRGLN---------FT 199
                ::.|:.|.|.:..:               .|:...:|:    :....|:|         |.
  Fly   188 ----SSMDDYGDPDHSYM---------------DDNSGEYMD----FAGFDGVNHSGFGTESDFL 229

  Fly   200 PLDKLYQ-----RCRECNKRIAMHSRE----NLLKHKFTHLPF-----------RCTKCYICK-- 242
            ..|::.:     |.||    :.||.::    ..|.|.:...||           |..:.....  
  Fly   230 SYDEMVEESLLGRDRE----VTMHIKDRKMIQFLIHSYQRNPFLWDHGNAQFRDRVKRARFLDWI 290

  Fly   243 -REYKYRQDLMV----------HLRMVHCDEVVAMMREGYNAAGRKTRV---------------- 280
             .|:|.|.::.:          :||.|:       .||....|..||.:                
  Fly   291 VLEFKSRFNISLAKDAITRKWDNLRTVY-------KRECNRMALEKTNISTLWYFKELHFLNEVY 348

  Fly   281 --RESRTEQLLREKSFRE------ND----DLGEESDRIEVRNELLEPDADESGTQEQTVSEEVS 333
              .:..::.:::|.|:|.      ||    .|.....|.:......:||..             |
  Fly   349 SYNDKMSDAVVKETSYRRRFSAIWNDTSTAKLLSMVKRYQCFYNRFDPDYR-------------S 400

  Fly   334 KKKAGTRGAAELCEDYIHYMCPDCGTDCD-THAQWSQHI----------------------EFVH 375
            |::.|         :.:|.|..:.....| |..|.|:.|                      :|:.
  Fly   401 KERRG---------EGLHQMAIELQQLIDVTTIQISKRISQLRFDYSKQKMERLNSERLGKKFIA 456

  Fly   376 DYVSRRGLNFRSVDM-QMQCLECKKIVTPNTIKSLRAHKFSHLSQPEW----------------- 422
            :|:....::|...|: ..:|..|.:||  .|::.|..|..:|  ||..                 
  Fly   457 NYLYYDQMHFMDDDIPPFKCAHCPEIV--QTLRELDLHMLTH--QPSLGGGYYCNICSIQFHNAQ 517

  Fly   423 -----------------LRCKLCYKGYTDHQEIIRHL-----------LQQHHM-------DTLM 452
                             ..|:||...:.:......||           |..:|.       |..:
  Fly   518 EFDNHKQLHLGGVTEIKFNCELCTASFREKANYDEHLRRHNEELFLPSLALNHSIMEGGLGDDEI 582

  Fly   453 SEDAEEEDGD--------APSAIEDECDGDN-----GNGEGNGAPLDEDSPYFEDAPRRG----G 500
            ..:.||..|.        |..|.:|..|.|:     |.|...|...|...||..|..||.    |
  Fly   583 GVEGEESRGSGSRRKRRHAAKATDDMVDDDDRIGGGGGGGSGGGGTDIAKPYGCDVCRRSFATPG 647

  Fly   501 RISSDDIFEPHID-----YLC--PQCGKEFIEKKHWRTHVVMAHSMNDLSKLNFEMINERQLKCT 558
            .:::..|.  |.|     |.|  |||.|.|:.:.....|:...:|            || :.||.
  Fly   648 HLNAHRIV--HQDERERCYKCDYPQCNKSFVARNSLFEHLKQHYS------------NE-EFKCD 697

  Fly   559 ECDKIITNAYGIQNAQQHRITHLPFKAYARCRKCHKSYTDRKGLVKHLATHHR 611
            .|.|...:.   :|.|.|:..|...|.|. |:.|..::....||..|...|:|
  Fly   698 ICGKTFKST---KNLQNHKQIHDKIKRYV-CQICGSAFAQAAGLYLHKRRHNR 746

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6791NP_650090.1 C2H2 Zn finger 167..188 CDD:275368 2/20 (10%)
C2H2 Zn finger 208..230 CDD:275368 6/25 (24%)
C2H2 Zn finger 235..256 CDD:275368 3/33 (9%)
C2H2 Zn finger 516..532 CDD:275368 6/17 (35%)
C2H2 Zn finger 557..580 CDD:275368 6/22 (27%)
C2H2 Zn finger 589..609 CDD:275368 5/19 (26%)
COG5236 <939..>1096 CDD:227561
CG8944NP_573065.1 MADF_DNA_bdg 259..344 CDD:287510 16/91 (18%)
MADF 379..472 CDD:214738 18/114 (16%)
C2H2 Zn finger 476..496 CDD:275368 7/21 (33%)
C2H2 Zn finger 506..526 CDD:275368 0/19 (0%)
C2H2 Zn finger 537..557 CDD:275368 5/19 (26%)
C2H2 Zn finger 636..656 CDD:275368 5/21 (24%)
zf-C2H2_8 639..712 CDD:292531 23/90 (26%)
C2H2 Zn finger 666..688 CDD:275368 7/21 (33%)
zf-C2H2 694..716 CDD:278523 7/24 (29%)
C2H2 Zn finger 696..716 CDD:275368 6/22 (27%)
zf-H2C2_2 708..733 CDD:290200 8/25 (32%)
C2H2 Zn finger 724..744 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455508
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.