DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6791 and CG2120

DIOPT Version :9

Sequence 1:NP_650090.1 Gene:CG6791 / 41391 FlyBaseID:FBgn0037918 Length:1243 Species:Drosophila melanogaster
Sequence 2:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster


Alignment Length:372 Identity:67/372 - (18%)
Similarity:113/372 - (30%) Gaps:143/372 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 FRENDDLGEESDRIEVRNELLEPDAD-------ESGTQEQTVSEE-----------VSKKKAGTR 340
            |.:.:||..|  |:.:..|||.|.::       ....|::..:|.           .:.|:..|.
  Fly    33 FAQLEDLSGE--RLPMEMELLNPGSEYDLLELVNGALQQRNTTEHKPTDMCKPKRTPTTKRHRTT 95

  Fly   341 GAAELC--------EDY---IHYMCPDCGTDCDTHAQWSQHIEFVHDYVSRRGLNFRSVDMQMQC 394
            |....|        |.|   ||.|         ||.....|:                      |
  Fly    96 GKDHTCDICDRRFSEAYNLRIHKM---------THTDEKPHV----------------------C 129

  Fly   395 LECKKIVTPNTIKSLRAHKFSHLSQ-PEWLRCKLCYKGY------TDHQEIIR------------ 440
            :||.|..  ..:..||.|..:|.:: |.  :|.:|.||:      |.|:.:..            
  Fly   130 VECGKGF--RQLNKLRIHAVTHTAERPH--KCDICGKGFRYANYLTVHRRLHTGEKPYPCLATDC 190

  Fly   441 ----HLLQQHHMDTLMSEDAEEEDGDAPSAIEDECDGDNGNGEGNGAPLDEDSPYFEDAPRRGGR 501
                |.:....:.|.:...|:.:.                         |.:.|..|...|....
  Fly   191 HLSFHSIHARRIHTKLRHAAQTDP-------------------------DPEHPLAEQEQRDTSA 230

  Fly   502 ISSDDIFEPHIDYLCPQCGKEFIEKKHWRTHVVMAHSMNDLSKLNFEMINERQLKC--TECDKII 564
            :|          :.||.|.:...::.:...|:          |.::   |:|...|  .||.|  
  Fly   231 LS----------FTCPVCSRVLTDQCYLSIHL----------KRHY---NQRDFPCPQPECGK-- 270

  Fly   565 TNAYGIQNAQQHRITHLPFKAYARCRKCHKSYTDRKGLVKHLATHHR 611
             ..:.....:.|:|.|...:.:| |..|...:..:....:||..|.|
  Fly   271 -RFFSASELKHHQIAHTQQRPFA-CPLCPARFLRKSNHKQHLKVHER 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6791NP_650090.1 C2H2 Zn finger 167..188 CDD:275368
C2H2 Zn finger 208..230 CDD:275368
C2H2 Zn finger 235..256 CDD:275368
C2H2 Zn finger 516..532 CDD:275368 3/15 (20%)
C2H2 Zn finger 557..580 CDD:275368 6/24 (25%)
C2H2 Zn finger 589..609 CDD:275368 4/19 (21%)
COG5236 <939..>1096 CDD:227561
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368 6/28 (21%)
zf-H2C2_2 113..138 CDD:290200 10/57 (18%)
C2H2 Zn finger 129..149 CDD:275368 7/21 (33%)
zf-H2C2_2 142..166 CDD:290200 9/25 (36%)
COG5048 151..>264 CDD:227381 22/162 (14%)
C2H2 Zn finger 157..177 CDD:275368 6/19 (32%)
C2H2 Zn finger 185..206 CDD:275368 2/20 (10%)
C2H2 Zn finger 235..255 CDD:275368 5/29 (17%)
C2H2 Zn finger 263..285 CDD:275368 6/24 (25%)
C2H2 Zn finger 293..313 CDD:275368 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.