DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6791 and LOC100365363

DIOPT Version :9

Sequence 1:NP_650090.1 Gene:CG6791 / 41391 FlyBaseID:FBgn0037918 Length:1243 Species:Drosophila melanogaster
Sequence 2:XP_006228060.2 Gene:LOC100365363 / 100365363 RGDID:2319215 Length:670 Species:Rattus norvegicus


Alignment Length:978 Identity:187/978 - (19%)
Similarity:290/978 - (29%) Gaps:379/978 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 DLMVHL-RMVHCDEVVAMMREGYNAAGRKTRVRESRTEQLLREKSFRENDDLGE---ESDRIEVR 310
            |.:.|. |.:|.|    :|.|.|:     ..|....|.|.|...|..|.:. |.   ||:.|..|
  Rat    23 DCLDHAQRALHRD----VMLENYS-----NLVSLGMTLQSLNAVSKLEQNK-GPWTVESEAIITR 77

  Fly   311 NELLEPDADESGTQEQTV---SEEVS--KKKAGTRGAAELCEDYIHYMCPDCGTDCDTHAQWSQH 370
                     :|..||..:   :|.:.  :.|:.:.|::.|..|.| ::..|             .
  Rat    78 ---------KSNVQEYAIAMNAENIDCMEAKSISNGSSILSSDRI-FLSGD-------------K 119

  Fly   371 IEFVHDY-----VSRRGLNFRSVDMQMQCLECKKIVTPNTIKSLRAHKFSHLSQPEWLRCKLCYK 430
            ..|||:|     :..:|......:...||.||.|:.  ....||..|:..|..: :..:|..|.|
  Rat   120 APFVHEYDVYSSLLMKGQKAAIKEKPYQCNECDKVF--RYTSSLAYHRQIHTGE-KLYKCVECGK 181

  Fly   431 GYTDHQEIIRHLLQQHHMDTLMSEDAEEEDGDAPSAIEDECDGDNGNGEGNGAPLDEDSPYFEDA 495
            .:.....::.|  ::||            .|..|                               
  Rat   182 AFFRRSYLLVH--ERHH------------SGAKP------------------------------- 201

  Fly   496 PRRGGRISSDDIFEPHIDYLCPQCGKEFIEKKHWRTHVVMAHSMNDLSKLNFEMINERQLKCTEC 560
                              |.|.:|||.|.:..|.::| ...|:            .|:..||.:|
  Rat   202 ------------------YKCNECGKVFSQNSHLKSH-RRIHT------------GEKPYKCNDC 235

  Fly   561 DKIITNAYGIQ-NAQQHRITHLPFKAYARCRKCHKSYTDRKGLVKHLATHHRVGWPRKLSGGCPA 624
            .|    |:.:: |...|.:.|...|.| :|.:|.|.::....|..|..||               
  Rat   236 GK----AFSVRSNLTHHLVIHTGDKPY-KCNECGKVFSQTSSLTIHRRTH--------------- 280

  Fly   625 PILTPAKQPRKQIVTVANETYEIIYLDDVDQGGMEEDNDFGEQMQAEEDEYPIAPPPPSPPPPPQ 689
                ..::|.:     .||..::          ....::..........|.|             
  Rat   281 ----TGEKPYR-----CNECGKV----------FSSHSNLNTHQAIHTGEKP------------- 313

  Fly   690 PTTQGNHQRYKCVHCGTLFATQAAV----RVHISEKRCRKTVVRRRRQPVMSSADPSVPTVEQNY 750
                     |||..||.:|...:.:    |.|..||.                            
  Rat   314 ---------YKCSECGKVFTQNSHLANHWRTHTGEKP---------------------------- 341

  Fly   751 IFLCPSCGFEYKTQFEWRRHINEVHNFDKRQYLNMRQLDKYRYQCTQC-KDIVCNSKLKGLQDHH 814
             :.|..||..:........|: .:|..:|            .|:|.:| |....||.|...:..|
  Rat   342 -YKCNECGKAFSVYSSLTTHL-AIHTGEK------------PYKCEECGKVFTQNSHLANHRGIH 392

  Fly   815 FRHLPYRLYLKCLICGTCYNHKPNIAAHLRARHSIFDRETPTMITKPKQVLGRYKDNSRENPKLP 879
            ....||    ||..||..:|...|:|.|.|    :...|.|            ||          
  Rat   393 SGEKPY----KCEECGKHFNQTSNLARHWR----VHTGEKP------------YK---------- 427

  Fly   880 SPPPAPALAPAPPSPPACSSSAAASASSRSLKP----QPGGLPARPAGLNTL---EDSISYHNAV 937
                             ||....|.:...||..    ..|..|.:.|....:   ..|:|.|..:
  Rat   428 -----------------CSECGKAFSVRSSLTSHQVIHTGEKPYKCAECGKVFSQTSSLSIHQRI 475

  Fly   938 DLDFITYFCPKCNQNFDSHAFWRKHIVEQHNFNSREGLNFRQIDNHHYLCLECYKRVTVTHTKGA 1002
            ......|.|.:|.:.|:||:          |.|:.:.::..|   ..|.||||.|..|..     
  Rat   476 HTGEKPYRCNECGKAFNSHS----------NLNTHQVIHTGQ---KPYKCLECGKVFTQN----- 522

  Fly  1003 IGQLQSHKFRHLPHRSFKCLTCGGEFVRKQMFFKHLNRDTNRCDNRPHREFDDDEPDQDTLLSTI 1067
             ..|.:|...|...:.:||..||      :.|..:.:..|::..:...:.|              
  Rat   523 -SHLANHHRTHTGEKPYKCNECG------KAFSVYSSLTTHQAIHTGEKPF-------------- 566

  Fly  1068 YHLTCPQCGDNFKTHNKKEWREHINDHHGLTKLELLHMTKVGEDVYRCQDCDEELE-----TNRQ 1127
               .|.:||..| |.|     .|:..|         ..|..||..|:|..|.:...     |..|
  Rat   567 ---KCNECGKVF-TQN-----SHLASH---------RRTHTGEKPYKCSKCGKAFSVRSSLTTHQ 613

  Fly  1128 WVLQFHRFQHLPHAA---------------YIRCKLCKQSSADGADAVGELHSLRELQQHIRKHH 1177
            .::......|:.:.|               .:..|||:.|.....|::        |.|     |
  Rat   614 AIILEKNLTHVVNVAKSLVEVPTLQVIKDFMLNRKLCQYSKVFRHDSL--------LAQ-----H 665

  Fly  1178 PGL 1180
            ||:
  Rat   666 PGI 668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6791NP_650090.1 C2H2 Zn finger 167..188 CDD:275368
C2H2 Zn finger 208..230 CDD:275368
C2H2 Zn finger 235..256 CDD:275368 2/6 (33%)
C2H2 Zn finger 516..532 CDD:275368 6/15 (40%)
C2H2 Zn finger 557..580 CDD:275368 6/23 (26%)
C2H2 Zn finger 589..609 CDD:275368 5/19 (26%)
COG5236 <939..>1096 CDD:227561 34/156 (22%)
LOC100365363XP_006228060.2 KRAB 8..68 CDD:214630 15/54 (28%)
SFP1 <143..221 CDD:227516 25/144 (17%)
C2H2 Zn finger 148..168 CDD:275368 7/21 (33%)
C2H2 Zn finger 176..196 CDD:275368 4/21 (19%)
COG5048 200..575 CDD:227381 112/628 (18%)
C2H2 Zn finger 204..224 CDD:275368 7/20 (35%)
C2H2 Zn finger 232..252 CDD:275368 6/23 (26%)
C2H2 Zn finger 260..280 CDD:275368 5/19 (26%)
C2H2 Zn finger 288..308 CDD:275368 2/29 (7%)
C2H2 Zn finger 316..336 CDD:275368 5/19 (26%)
C2H2 Zn finger 344..364 CDD:275368 4/20 (20%)
C2H2 Zn finger 372..392 CDD:275368 6/19 (32%)
C2H2 Zn finger 400..420 CDD:275368 8/23 (35%)
C2H2 Zn finger 428..448 CDD:275368 5/19 (26%)
C2H2 Zn finger 456..476 CDD:275368 4/19 (21%)
C2H2 Zn finger 484..504 CDD:275368 7/29 (24%)
C2H2 Zn finger 512..532 CDD:275368 8/25 (32%)
C2H2 Zn finger 540..560 CDD:275368 5/25 (20%)
C2H2 Zn finger 568..588 CDD:275368 8/34 (24%)
zf-H2C2_2 580..604 CDD:404364 8/32 (25%)
C2H2 Zn finger 596..615 CDD:275368 4/18 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335943
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.