DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and RABGAP1L

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001353375.1 Gene:RABGAP1L / 9910 HGNCID:24663 Length:1051 Species:Homo sapiens


Alignment Length:322 Identity:85/322 - (26%)
Similarity:145/322 - (45%) Gaps:34/322 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 WLYMIDNWSIYMSKNYKKIRDRCRKGIPKSVRPKAWFYLSGAY----LLKKKNPNVYNELLEKPG 112
            |..::..|...:....|.:....:.|:|:::|.:.|..|:|.:    :|.:     |..|:.|..
Human   513 WGELLGKWHSNLGARPKGLSTLVKSGVPEALRAEVWQLLAGCHDNQAMLDR-----YRILITKDS 572

  Fly   113 NPTTIEEIKKDKHRQFPFHEMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLP 177
            ...::  |.:|.||.||.|:.|.|....||..|:.:.||||:|:..:|:||.|:.:||.||:|:|
Human   573 AQESV--ITRDIHRTFPAHDYFKDTGGDGQESLYKICKAYSVYDEDIGYCQGQSFLAAVLLLHMP 635

  Fly   178 AEDAFWVFVSVC-DVYLQDYFIPGLEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWF 241
            .|.||.|.|.:. |..|:|.:....|.:......||.|:::..|.::.|.....:|..:|.:.||
Human   636 EEQAFCVLVKIMYDYGLRDLYRNNFEDLHCKFYQLERLMQEQLPDLHSHFSDLNLEAHMYASQWF 700

  Fly   242 LCAMTRTLPWETLLRVWDCFLAEGIRVIFKVALVIIGASL--------------------SRHKV 286
            |...|...|...:..:.|..|.||:.:||.|||.::..|.                    .|::.
Human   701 LTLFTAKFPLCMVFHIIDLLLCEGLNIIFHVALALLKTSKEDLLQADFEGALKFFRVQLPKRYRA 765

  Fly   287 RKTCTGLCETLAVLRSPEEHIVEEEFIINNMMRLNLRVEDFQIEHTRQKAR--RAKQKAQQE 346
            .:....|.|....::.|.:.:.:.|.....|....|:.||....:.|:..|  .|..:.:||
Human   766 EENARRLMEQACNIKVPTKKLKKYEKEYQTMRESQLQQEDPMDRYKRENRRLQEASMRLEQE 827

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 57/163 (35%)
RABGAP1LNP_001353375.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52
PTB_Rab6GAP 129..257 CDD:269922
DUF3694 290..421 CDD:315198
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 461..503
RabGAP-TBC 541..744 CDD:306939 66/209 (32%)
DUF3084 800..>1018 CDD:331293 8/28 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.