DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and TBC1D5

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001127853.1 Gene:TBC1D5 / 9779 HGNCID:19166 Length:817 Species:Homo sapiens


Alignment Length:395 Identity:86/395 - (21%)
Similarity:140/395 - (35%) Gaps:133/395 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LDTISLCSTVS-SCPDRNGFYGGFQRTDKPKEPLSKAQIIAREKKWLYMIDNWSIYMSKNY-KKI 70
            :|.:|..|..| ...::||     :||....:  |:....:..|:|      ..::::.|| ..|
Human    21 IDPLSSYSNKSGGDSNKNG-----RRTSSTLD--SEGTFNSYRKEW------EELFVNNNYLATI 72

  Fly    71 RDRCRKGIPKSVRP-----------------------------KAWF------------YLSGAY 94
            |   :|||...:|.                             :||:            .:.|..
Human    73 R---QKGINGQLRSSRFRSICWKLFLCVLPQDKSQWISRIEELRAWYSNIKEIHITNPRKVVGQQ 134

  Fly    95 LLKKKNP------NVYNELLEKPGNPTTIEEIKKDKHRQFPFHEM-FLDEQKVGQIELFNVLKAY 152
            .|...||      :::|:..:.....:.||:   |..|.||  || |..::.|.:| |.:||..|
Human   135 DLMINNPLSQDEGSLWNKFFQDKELRSMIEQ---DVKRTFP--EMQFFQQENVRKI-LTDVLFCY 193

  Fly   153 SIYNP----KVGFCQAQAPIAAFL------LMHL-----PAE-------------DAFWVFVSVC 189
            :..|.    |.|..:..|||...|      .:|.     |:|             ||:.||..:.
Human   194 ARENEQLLYKQGMHELLAPIVFVLHCDHQAFLHASESAQPSEEMKTVLNPEYLEHDAYAVFSQLM 258

  Fly   190 DVYLQDYFI--------------------------PGLEVIQNDAGILEGLLKKTCPPVYRHLQK 228
            :. .:.:|.                          |.:.::.....|.:.||||....:|.||.:
Human   259 ET-AEPWFSTFEHDGQKGKETLMTPIPFARPQDLGPTIAIVTKVNQIQDHLLKKHDIELYMHLNR 322

  Fly   229 HKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFLAEGIRV-----IFKVALVIIGASLSRHKVRK 288
            .::.|.:|...|......|..|.:.||.|||...|:|:.:     ||...|:.|..:|..... :
Human   323 LEIAPQIYGLRWVRLLFGREFPLQDLLVVWDALFADGLSLGLVDYIFVAMLLYIRDALISSNY-Q 386

  Fly   289 TCTGL 293
            ||.||
Human   387 TCLGL 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 54/222 (24%)
TBC1D5NP_001127853.1 TBC 79..381 CDD:214540 63/308 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.