DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and GYP5

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_015075.1 Gene:GYP5 / 855827 SGDID:S000006170 Length:894 Species:Saccharomyces cerevisiae


Alignment Length:267 Identity:70/267 - (26%)
Similarity:123/267 - (46%) Gaps:32/267 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 WLYMIDNWSIYMSKNYKKIRDRCRKGIPKSVRPKAWFYLSGAYLLKKKNPNVYNELLEKPGNPTT 116
            |..::::::...|...:.:......|||..:|...|..::.:  ..::..::|..||:    ...
Yeast   426 WTQVVNDYATVASNEPENLEAHVTNGIPPQIRGIIWQLMANS--KSREMEDIYETLLD----TEC 484

  Fly   117 IEE--IKKDKHRQFPFHEMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAE 179
            :.|  |::|..|     ..|:.|.|:.  .|:.|:|.||:|:|.||:.|....|||.||::...|
Yeast   485 LHEATIRRDLRR-----TKFVAEDKME--SLYKVIKVYSVYDPDVGYTQGMGFIAAPLLINCENE 542

  Fly   180 -DAFWVFVSVCDVY-LQDYFIPGLEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFL 242
             ::|.:.|.:...| |::.|:||:..:.......:.||::..|.:|..|.:..:...:|.|.|||
Yeast   543 AESFGLLVGLMKNYGLRELFLPGMPGLMLMLYQFDRLLEEHSPSLYNRLIREGISSTMYATQWFL 607

  Fly   243 CAMTRTLPWETLLRVWDCFLAEGIRVIFKVALVIIGASLSRHKVRKTCTGLCETLAVLRSPE--E 305
            .......|.|.:||::|....|||.|:.|.|   :...|...          |||..||..|  :
Yeast   608 TFFAYKFPLEFVLRIFDIVFVEGIEVLLKFA---VNLMLKNE----------ETLVKLRFDELLD 659

  Fly   306 HIVEEEF 312
            .:.:|.|
Yeast   660 FLKDELF 666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 51/166 (31%)
GYP5NP_015075.1 COG5210 154..737 CDD:227535 70/267 (26%)
SMC_prok_B 726..>891 CDD:274008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.