DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and MSB4

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_014529.1 Gene:MSB4 / 854037 SGDID:S000005472 Length:492 Species:Saccharomyces cerevisiae


Alignment Length:347 Identity:88/347 - (25%)
Similarity:140/347 - (40%) Gaps:75/347 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 REKKWLYMI---------DNWSIYMSKNYKKIRDRCRKGIPKSVRPKAWFYLSGAYLLKKKNPNV 103
            |:|||...:         ||..:|.::. .::....|||||...|..||:|.:|.......|..|
Yeast   110 RKKKWENFLLKNKIELHNDNPLVYPART-DELSKFVRKGIPAEWRGNAWWYFAGGQRQLDANVGV 173

  Fly   104 YNEL----LEKPGNPTTIEEIKKDKHRQFP----FH-EMFLDEQKVGQIELFNVLKAYSIYNPKV 159
            |:.|    .|...:...:|.|::|.:|.||    || |.|.:.:......|..||.|:|:|:..:
Yeast   174 YDRLKSDCREGAVSGKDMEAIERDLYRTFPDNIHFHKESFQNGEPAIIRSLRRVLMAFSVYDKTI 238

  Fly   160 GFCQAQAPIAAFLLMHLPAEDAFWVFVSVCDVYLQDYFIPGLEVIQNDAGILEGLLKKTCPPVYR 224
            |:||:...:...||:.:..|.|||:.|.:...||...:...||....|.|:|...:|:..|.::.
Yeast   239 GYCQSMNFLVGLLLLFMEEEKAFWMLVIITGKYLPGVYESDLEGANVDQGVLVLCIKEYLPEIWS 303

  Fly   225 HLQKHKVE---------------------PLLYM--TDWFLCAMTRTLPWETLLRVWDCFLAEGI 266
            |::...:.                     |.|.:  ..||:......:|.||.||:|||...|..
Yeast   304 HIESSYMNGNGSTDQISGPASGEEYLCRLPTLTLCTASWFMSCFVGVVPIETTLRIWDCLFYEES 368

  Fly   267 RVIFKVALVIIGASLSRHKVRKTCTGLCETLAVLRSPEEHIVEEEFIINNMMRLNLRVEDFQIEH 331
            ..:|||||.|:..|                            |.||:.:...:|..:...:....
Yeast   369 HFLFKVALGILKLS----------------------------ESEFLESKSQKLFRQYSSYTFGG 405

  Fly   332 TRQ-----KARRAKQKAQQEAE 348
            :..     |..:.|.|.|:||:
Yeast   406 SNDSDSTFKRLKNKIKTQEEAD 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 54/190 (28%)
MSB4NP_014529.1 COG5210 <53..461 CDD:227535 88/347 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.