DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and GYP6

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_012491.3 Gene:GYP6 / 853406 SGDID:S000003580 Length:458 Species:Saccharomyces cerevisiae


Alignment Length:186 Identity:40/186 - (21%)
Similarity:63/186 - (33%) Gaps:49/186 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 IELFNVLKAYSIYNPKVGFCQAQAPIAAFLLM----HLPAEDAFWVFVSVCDVYLQDYFIPGLE- 202
            ::|..::.......||| ..|.:..:..:||:    ||..:..|...:||  :|||.|....|: 
Yeast   151 LDLSRIMLDDIFQEPKV-HAQMRQLLYNYLLIHQSEHLQYKQGFHEILSV--IYLQLYHGTDLDN 212

  Fly   203 -VIQNDAGILEGLLKKTCPPVYRH----------------------LQKHKVEP----------- 233
             .:||...|...|:.:..|..|..                      ..|...:|           
Yeast   213 TDLQNVLIIFNKLMNQIEPIFYNEENLINWDKRVFTKIFRICLPDLFSKVFYQPPKTGSGKKKNV 277

  Fly   234 -------LLYMTDWFLCAMTRTLPWETLLRVWDCFLAEGIRVIFKVALVIIGASLS 282
                   |:::..|......|.||.:.:|.|||..|.....:...:|..||...||
Yeast   278 DHLIHSNLIWLIRWTRLLFLRELPLKYVLIVWDHVLTFNYPLDIFIACTIITLLLS 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 36/179 (20%)
GYP6NP_012491.3 TBC <145..336 CDD:214540 40/186 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.