DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and GYP7

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_010047.1 Gene:GYP7 / 851364 SGDID:S000002393 Length:746 Species:Saccharomyces cerevisiae


Alignment Length:233 Identity:44/233 - (18%)
Similarity:90/233 - (38%) Gaps:50/233 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 IELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAE-DAFWVFVSVCDVYLQDYFIPGLEVIQN 206
            |.|.|:|..|::||..:|:.|....:.:.:.:.:..| ..||.|....|:..:::       :::
Yeast   511 IHLQNILITYNVYNTNLGYVQGMTDLLSPIYVIMKEEWKTFWCFTHFMDIMERNF-------LRD 568

  Fly   207 DAGILEGLL------KKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCF---- 261
            .:||.|.:|      :...|.:..||.|.....|.:.....|....|....|.::.:|:.|    
Yeast   569 QSGIHEQMLTLVELVQLMLPELSEHLNKCDSGNLFFCFRMLLVWFKREFEMEDIMHIWENFWTFY 633

  Fly   262 LAEGIRVIFKVALVIIGASLSRHKVRKTCTGLCETLAVLRSPEEHIVEEEFIINNMMRLNLRVE- 325
            .:...::.|.:|:           ::|      .:.|:|    :|:.:.:.|:.....||.::: 
Yeast   634 YSSQFQLFFMLAI-----------LQK------NSQAIL----QHLNQFDQILKFFNELNGKLDW 677

  Fly   326 -DFQI---------EHTRQKARRAKQKAQQEAESSGSG 353
             |..:         |.......|..|.....:.||.:|
Yeast   678 NDLMVRAELLFKKFEKMMHVMERDLQNVSSSSSSSSTG 715

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 30/144 (21%)
GYP7NP_010047.1 COG5210 134..738 CDD:227535 44/233 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.