DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and AT3G02460

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_566172.1 Gene:AT3G02460 / 821261 AraportID:AT3G02460 Length:353 Species:Arabidopsis thaliana


Alignment Length:341 Identity:100/341 - (29%)
Similarity:168/341 - (49%) Gaps:38/341 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DRNGFYGGFQRTDKPKEPLSKAQIIA-----RE----KKWLYMI----DNWSIYMSKNYKKIRDR 73
            ||.||..  |......|..||::..:     ||    :||..||    .:|..|:.:....:|.|
plant    22 DRFGFLK--QEHANSPERFSKSKTTSSTDHDREERKVRKWRKMIGVGGSDWKHYVRRKPNVVRRR 84

  Fly    74 CRKGIPKSVRPKAWFYLSGAYLLKKKNPNVYNELLEKPGNPTTIEEIKKDKHRQFPFHEMFLDEQ 138
            .|||||..:|...|..:||:..|...||.||.:|:....:.:.: :|.:|..|.||.|..|....
plant    85 IRKGIPDCLRGLVWQLISGSRDLLLMNPGVYEQLVIYETSASEL-DIIRDISRTFPSHVFFQKRH 148

  Fly   139 KVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAEDAFWVFVSV----CDVYLQDYFIP 199
            ..||..|:|||||||:|:..||:.|....||..||:::..|||||:.|::    ....::..:..
plant   149 GPGQRSLYNVLKAYSVYDRDVGYVQGMGFIAGLLLLYMSEEDAFWLLVALLKGAVHAPMEGLYHA 213

  Fly   200 GLEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFLAE 264
            ||.::|.....||.|:|:..|.:..|..:..:.|.:|.:.||:...:.:.|:...||:||.||:|
plant   214 GLPLVQQYLFQLESLVKELIPKLGEHFTQEMINPSMYASQWFITVFSYSFPFPLALRIWDVFLSE 278

  Fly   265 GIRVIFKVALVIIGASLSRHKVRKTCTGLCETL-------AVLRSPEEHIVEEEFI-INNMMRLN 321
            |::::|||.|.::          |.|......|       |:...||:.:..:..: :...::::
plant   279 GVKIVFKVGLALL----------KYCQDELVKLPFEKLIHALKTFPEDAMNPDTLLPLAYSIKVS 333

  Fly   322 LRVEDFQIEHTRQKAR 337
            .|:|:..:|:.:..|:
plant   334 KRLEELTLEYQKTNAK 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 57/166 (34%)
AT3G02460NP_566172.1 TBC 85..299 CDD:214540 74/224 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1545
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D976276at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.