DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and si:dkey-238d18.4

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_003200122.1 Gene:si:dkey-238d18.4 / 796120 ZFINID:ZDB-GENE-131121-307 Length:472 Species:Danio rerio


Alignment Length:239 Identity:52/239 - (21%)
Similarity:93/239 - (38%) Gaps:39/239 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 IEEIKKD---KHRQFPFHEMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPA 178
            |..|.||   ..|..|::.   :|.....:.|.::|..|:.::|:|.:.|....:.:..|..|.:
Zfish   202 IRIIDKDVPRTDRDLPYYR---NEGLGNLLVLRDILITYAAFHPEVSYAQGMNDLCSRFLEVLDS 263

  Fly   179 E-DAFWVFVSVCDVYLQDYFIPGL-EVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWF 241
            | |.:|.|....:.:.:|:...|| ..::.:|    .|||:..|.::.||....:|.|.:...|.
Zfish   264 EVDTYWSFSCYMEKFSKDFRADGLYRKMELEA----ALLKELDPQLHSHLVTDNMERLTFCHRWL 324

  Fly   242 LCAMTRTLPWETLLRVWDCFLAEGIRVIFKVALVIIGASLSRHKVRKTCTGLCETLAVLRSPEE- 305
            |....|.......||:::....:.:.:|.:               :..|....|.||...|.|| 
Zfish   325 LLGFQREFEHSDALRLFEILSCDHLELISQ---------------QVDCVRYQERLARKHSLEEE 374

  Fly   306 -----HIVEEEFIINNMMRLNLRVEDFQIEHTRQKARRAKQKAQ 344
                 |.|..:|.....|...:.:|:      |:.....|.:.|
Zfish   375 PVADLHAVNTDFTFELFMCATILLEN------REALLSCKNEVQ 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 37/164 (23%)
si:dkey-238d18.4XP_003200122.1 TBC <204..352 CDD:214540 35/154 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.