DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and Tbc1d21

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_083130.1 Gene:Tbc1d21 / 74286 MGIID:1921536 Length:336 Species:Mus musculus


Alignment Length:273 Identity:60/273 - (21%)
Similarity:103/273 - (37%) Gaps:75/273 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DKPKEPLSKAQIIAREKKWLYMIDNWSIYMSKNYKKIRDR---C----RKGIPKSVRPKAWFYLS 91
            :|...|:.||:              |..:..:|....:.|   |    .:|:...||.:||.:|:
Mouse    21 EKRNPPIDKAE--------------WDSFFDENGHLAKSRDFICINILERGLHPFVRTEAWKFLT 71

  Fly    92 GAY---------LL----KKKNPNVYNELLEK--------PGNPT-TIEEIKKDKHRQF---PFH 131
            |.|         |:    :::|.|...::.||        .||.| |...|..|..|.:   |..
Mouse    72 GYYSWQSSRDERLMVDSNRRRNYNSLCQMYEKIQPLLENLHGNFTETRNNIAYDIQRLYDKDPLG 136

  Fly   132 EMFLDEQKVGQIELFNVLKAYSIYNPKV----GFCQAQAPIAAFLLMHLPAEDAFWVFVSVCDVY 192
            .:.:|::|:.:    .:|.:| :.|.|.    ||.:.   :..|.||.....:.||:|       
Mouse   137 NVLIDKKKLEK----TLLLSY-VCNTKAEYQRGFHEM---VMLFQLMVEHDHETFWLF------- 186

  Fly   193 LQDYFIPGLE---VIQNDAG----ILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWF-LCAMTRTL 249
              .:|:...|   ||....|    :|..|:....|....||:......:..:..|| ||......
Mouse   187 --QFFLQKTEHSCVINIGVGKNLDMLNSLITLLDPEFAEHLKGKGSGAVQSLFPWFCLCFQRAFK 249

  Fly   250 PWETLLRVWDCFL 262
            .::.:.|:|:..|
Mouse   250 TFDDVWRLWEVLL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 37/165 (22%)
Tbc1d21NP_083130.1 TBC 62..287 CDD:214540 51/218 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.