DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and tbc1d2b

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_012822167.2 Gene:tbc1d2b / 734055 XenbaseID:XB-GENE-5932742 Length:944 Species:Xenopus tropicalis


Alignment Length:383 Identity:100/383 - (26%)
Similarity:177/383 - (46%) Gaps:54/383 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TVSSCPDRNGFYGGFQRTDKPKEPLSKAQIIAREKKWLYMIDN--------WSIYMSKNYKK--- 69
            |||.. |.:||.  ....|..:|....|::.|.:.|.|.:.:|        |..|.:....:   
 Frog   570 TVSKY-DIHGFL--IVPEDDEEEEKLVAKVRALDLKTLSLTENQEISNVVKWDNYFASTVNREMA 631

  Fly    70 ----IRDRCRKGIPKSVRPKAWFYLSGAYLLKKKN---PNVYNELLE---KPGNPTTIEEIKKDK 124
                ::...|.|||...|.:.|.:.:..::.|.|:   |..:..||:   :..||.: ::|:.|.
 Frog   632 CSPELKALVRNGIPHEHRSRMWKWFTNLHIKKLKDEAAPGYFQSLLQNALEKQNPAS-KQIELDL 695

  Fly   125 HRQFPFHEMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAEDAFWVFVSVC 189
            .|..|.::.:......|..:|.|||.|||..||.:|:||....:||..|::|..|||||..|::.
 Frog   696 MRTLPNNKHYTSPTSEGIQKLRNVLLAYSWRNPDIGYCQGINRLAAIALLYLDQEDAFWCLVTIV 760

  Fly   190 DVYL-QDYFIPGLEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWET 253
            :.:: :||:...|...|.|..:.:.|:.:..|.:..|.:::||:..|...:|||.....::..:.
 Frog   761 EAFMPRDYYTKTLLGSQVDQRVFKDLMNEKLPRLCAHFEQYKVDYTLITFNWFLVVFVDSVVSDI 825

  Fly   254 LLRVWDCFLAEGIRVIFKVALVIIGASLSRHKVRKTCTGLCETLAV---LRSPEEHIVEEEFIIN 315
            |.|:||..|.||.:|||:.||     .|.::| .:....|.:::::   ||.....|::...:.|
 Frog   826 LFRIWDSLLYEGSKVIFRFAL-----GLFKYK-EEEILKLQDSMSIFKYLRYFSRTILDARKLCN 884

  Fly   316 ----NMMRLNLR---------VEDFQIEHTRQKARRAKQKAQQEAESSGSGNGHRRNM 360
                :|....||         :|..::|.:..:|.||....::|.      |..||::
 Frog   885 IAFVDMNPFPLRQIRNRRTYHLEKVRLELSELEAIRADFIRERET------NPERRDL 936

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 54/163 (33%)
tbc1d2bXP_012822167.2 PH_TBC1D2A 34..134 CDD:269966
BAR 313..>425 CDD:416402
Smc <324..532 CDD:224117
TBC 640..857 CDD:214540 68/223 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.