DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and TBC1D3

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001116863.3 Gene:TBC1D3 / 729873 HGNCID:19031 Length:549 Species:Homo sapiens


Alignment Length:358 Identity:98/358 - (27%)
Similarity:150/358 - (41%) Gaps:70/358 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GGFQRTDKPKEPLSKAQI------IAREKKWLYMIDNWSIYMSKNYKKIRDRCRKGIPKSVRPKA 86
            |....|:.|  ||:..:.      |:|:.||:.|:.:|..|  |:.:|:.||..||:|.::|...
Human    50 GIVHETELP--PLTAREAKQIRREISRKSKWVDMLGDWEKY--KSSRKLIDRAYKGMPMNIRGPM 110

  Fly    87 WFYLSGAYLLKKKNPNVYNELLEKPGNPTT--IEEIKKDKHRQFPFHEMFLDEQKVGQIELFNVL 149
            |..|.....:|.|||..| :::::.|..::  |:.|.:|.......|..|.|.....|.||.::|
Human   111 WSVLLNTEEMKLKNPGRY-QIMKEKGKRSSEHIQRIDRDVSGTLRKHIFFRDRYGTKQRELLHIL 174

  Fly   150 KAYSIYNPKVGFCQAQAPIAAFLLMHLPAEDAFWVFVSVCDV---YLQDYFIPGLEVIQNDAGIL 211
            .||..|||:||:|:..:.|||..|::||.|||||..|.:...   .||.:..|....:|......
Human   175 LAYEEYNPEVGYCRDLSHIAALFLLYLPEEDAFWALVQLLASERHSLQGFHSPNGGTVQGLQDQQ 239

  Fly   212 EGLLKKTCPPVYRHLQKH----KVEPL----LYMTDWFLCAMTRTLPWETLLRVWDCFLAEG--- 265
            |.::..:.|....|..|.    :..||    ..:.|.....:|        ||:||.:|.||   
Human   240 EHVVATSQPKTMGHQDKKDLCGQCSPLGCLIRILIDGISLGLT--------LRLWDVYLVEGEQA 296

  Fly   266 ----IRVIFKVALVIIGASLSRHKVRKTCTGLCETLAVLRSPEEHIVEEEFIINNMMRLNLRVED 326
                .|:.|||           .:.|.|.|..|...|             ...|..:....|.||
Human   297 LMPITRIAFKV-----------QQKRLTKTSRCGPWA-------------RFCNRFVDTWARDED 337

  Fly   327 FQIEHTRQKARRAKQK-------AQQEAESSGS 352
            ..::|.|...::..:|       |:.|..||.|
Human   338 TVLKHLRASMKKLTRKKGDLPPPAKPEQGSSAS 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 53/182 (29%)
TBC1D3NP_001116863.3 TBC 99..312 CDD:214540 65/232 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 350..419 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D976276at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.