DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and Tbc1d8

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_006244913.1 Gene:Tbc1d8 / 680133 RGDID:1595491 Length:1150 Species:Rattus norvegicus


Alignment Length:404 Identity:110/404 - (27%)
Similarity:173/404 - (42%) Gaps:89/404 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TAPRSLDTIS-LCSTVSSCPDRNGFYGGF--------QRTDKPKEPL----------------SK 42
            |:|...|..| :..:.|.|.|:   :|..        :..:|.|.||                |.
  Rat   419 TSPSDDDMASPVFYSTSICTDK---FGDLEMVSSQSSEEREKEKSPLPHPEPLTAVFQQSGSQSP 480

  Fly    43 AQIIAREKKWLYMIDNWSIYMSK--------NYKKIRDRCRKGIPKSVRPKAWFYLSGAYLLKKK 99
            ...::||:   ..|..|:.:.::        ..:|||.....|||:|:|.:.|...|.|......
  Rat   481 DSRLSREQ---IKISLWNDHFAEYGRTVCMFRTEKIRKLVAMGIPESLRGRLWLLFSDAVTDLAS 542

  Fly   100 NPNVYNELLEKP-GNPTTI-EEIKKDKHRQFPFHEMFLDEQKVGQIELFNVLKAYSIYNPKVGFC 162
            :|..|..|:|:. |....: |||::|.||..|.|..|.:|  .|...|..||.||:..|||:|:|
  Rat   543 HPGYYGNLVEQSLGRCCLVTEEIERDLHRSLPEHPAFQNE--TGIAALRRVLTAYAHRNPKIGYC 605

  Fly   163 QAQAPIAAFLLMHLPAEDAFWVFVSVCDVYLQDYFIPGLEVIQNDAGILEGLLKKTCPPVYRHLQ 227
            |:...:.:.||::...|:|||:.|:||:..|.|||...:...|.|..:.|.|:|:..|.:..|:.
  Rat   606 QSMNILTSVLLLYAKEEEAFWLLVAVCERMLPDYFNHRVIGAQVDQSVFEELIKEHLPELAEHMS 670

  Fly   228 KHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFLAEGIRVIFKVALVIIGASLSRHKVRKTCTG 292
            .......:.:: |||......:|.|:.:.|.|||..:||:.||::.|.::.|:...         
  Rat   671 DLSALASISLS-WFLTLFLSIMPLESAVNVVDCFFYDGIKAIFQLGLAVLEANAEE--------- 725

  Fly   293 LC------ETLAVLRSPEEHIVEEE-----------FI-----------INNMMR------LNLR 323
            ||      :.|.:|....:||..|:           |.           |.:::|      .|..
  Rat   726 LCSSKDDGQALMILSRFLDHIKNEDSPGPPIGSHHAFFSDDQEPCPVTDIADLIRDSYEKFGNQS 790

  Fly   324 VEDFQIEHTRQKAR 337
            ||  ||||.|.|.|
  Rat   791 VE--QIEHLRCKHR 802

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 56/163 (34%)
Tbc1d8XP_006244913.1 PH-GRAM1_TBC1D8 171..269 CDD:270156
PH-GRAM2_TBC1D8 311..406 CDD:270160
TBC 520..726 CDD:214540 70/217 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.