DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and Grtp1

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001355787.1 Gene:Grtp1 / 66790 MGIID:1914040 Length:359 Species:Mus musculus


Alignment Length:279 Identity:90/279 - (32%)
Similarity:139/279 - (49%) Gaps:36/279 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GFQRTD-----KPKEPLSKAQIIAREK--KWLYMI-DNWSIYMSKNYKKIRDRCRKGIPKSVRPK 85
            ||:|.:     ..:|..|...:|..::  ||..:: .|..:..|...|:.   .|||||...|.:
Mouse    21 GFERPEDFDYAAYEEFFSTYLVILTKRAIKWSKLLKGNGGVRKSVTVKRY---VRKGIPLEHRAR 82

  Fly    86 AWFYLSGAYLLKKKNPNVYNELLEKPGNPTTIEEIKKDKHRQFPFHEMFLDEQKVG----QIELF 146
            .|..:|||.....::|..|:.|||...:.:..|.|:.|.:|.||.:.||   :|..    |..|:
Mouse    83 VWMAVSGAQARMDQSPGYYHRLLEGESSSSLDEAIRTDLNRTFPDNVMF---RKTADPCLQKTLY 144

  Fly   147 NVLKAYSIYNPKVGFCQ--AQAP---------------IAAFL-LMHLPAEDAFWVFVSVCDVYL 193
            |||.||.::||.||:||  ||.|               ||.:| |:....|::||:..::....|
Mouse   145 NVLLAYGLHNPDVGYCQCCAQKPGSSAGLRSSLTGMNFIAGYLILITKNEEESFWLLDALVGRIL 209

  Fly   194 QDYFIPGLEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVW 258
            .||:.|.:..::.|..:|..|::...|.|...:..|.|...|.::.||:|.....||.||:||:|
Mouse   210 PDYYSPAMLGLKTDQEVLAELVRMKLPAVAALMDGHGVLWTLLVSRWFICLFVDILPVETVLRIW 274

  Fly   259 DCFLAEGIRVIFKVALVII 277
            ||...||.::||:|||.:|
Mouse   275 DCLFNEGSKIIFRVALTLI 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 63/184 (34%)
Grtp1NP_001355787.1 TBC 71..301 CDD:214540 79/226 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.