DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and Tbc1d15

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_006514020.1 Gene:Tbc1d15 / 66687 MGIID:1913937 Length:688 Species:Mus musculus


Alignment Length:367 Identity:77/367 - (20%)
Similarity:140/367 - (38%) Gaps:77/367 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GFQ---RTDKPKEPLSKAQIIAREKKWLYMID--NWSIYMSKNYKKIRDRCRKGIPKSVRPKAWF 88
            ||:   |.|..:.|:.:.:.....::|...:|  ...:.:....:||   .|.|:..|:|.:||.
Mouse   296 GFEVITRIDLGERPVVQRREPVSLEEWNKSLDPEGRLVAVESMKQKI---FRGGLSHSLRKQAWK 357

  Fly    89 YLSGAY-----------LLKKKNPNVYNELLEKPGNPTTIEE-----------IKKDKHRQFPFH 131
            :|.|.:           |.|:|....:...|:........|:           |:||.:|....:
Mouse   358 FLLGYFPWDSTKEERTQLQKQKTDEYFRMKLQWKSVSEAQEKRNSRLRDYRSLIEKDVNRTDRTN 422

  Fly   132 EMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAE-DAFWVFVSVCDVYLQD 195
            :.:..:...|.|.|.::|..|.:|:..:|:.|..:.:.:.||..:..| ||||.|.|..|...|:
Mouse   423 KFYEGQDNPGLILLHDILMTYCMYDFDLGYVQGMSDLLSPLLYVMENEVDAFWCFASYMDQMHQN 487

  Fly   196 Y--FIPGL--EVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLR 256
            :  .:.|:  ::||     |..||:........:|:......|.:...|.|....|...:..:||
Mouse   488 FEEQMQGMKTQLIQ-----LSTLLRLLDSGFCSYLESQDSGYLYFCFRWLLIRFKREFSFLDILR 547

  Fly   257 VWDCFLAEGIRVIFKVALVIIGASLSRHKVRKTCTG----LCETLAVLRSPEEHIVEEEFIIN-- 315
            :|:....|                       ..|..    ||  .|:|.|.::.|:.:.:..|  
Mouse   548 LWEVMWTE-----------------------LPCKNFHLLLC--CAILESEKQQIMAKHYGFNEI 587

  Fly   316 ----NMMRLNLRVEDF--QIEHTRQKARRAKQKAQQEAESSG 351
                |.:.:.:.|||.  :.|....:..:.|:..|...|..|
Mouse   588 LKHINELSMKIDVEDILCKAEAISLQMAQCKELPQAVCEILG 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 39/178 (22%)
Tbc1d15XP_006514020.1 DUF3548 10..211 CDD:371881
TBC 343..578 CDD:214540 57/264 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.