DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and TBC1D15

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_006719627.1 Gene:TBC1D15 / 64786 HGNCID:25694 Length:699 Species:Homo sapiens


Alignment Length:366 Identity:80/366 - (21%)
Similarity:145/366 - (39%) Gaps:75/366 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GFQ---RTDKPKEPLSKAQIIAREKKWLYMIDN-WSIYMSKNYKKIRDRCRKGIPKSVRPKAWFY 89
            ||:   |.|..:.|:.:.:.....::|...||: ..|....|.|::  ..|.|:..::|.:||.:
Human   304 GFEVITRIDLGERPVVQRREPVSLEEWTKNIDSEGRILNVDNMKQM--IFRGGLSHALRKQAWKF 366

  Fly    90 LSGAY-----------LLKKKNPNVYNELL-------EKPGNPTTIEE----IKKDKHRQFPFHE 132
            |.|.:           |.|:|....:...|       |:....:.:.:    |:||.:|....::
Human   367 LLGYFPWDSTKEERTQLQKQKTDEYFRMKLQWKSISQEQEKRNSRLRDYRSLIEKDVNRTDRTNK 431

  Fly   133 MFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAE-DAFWVFVSVCDVYLQDY 196
            .:..:...|.|.|.::|..|.:|:..:|:.|..:.:.:.||..:..| ||||.|.|..|...|::
Human   432 FYEGQDNPGLILLHDILMTYCMYDFDLGYVQGMSDLLSPLLYVMENEVDAFWCFASYMDQMHQNF 496

  Fly   197 --FIPGL--EVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRV 257
              .:.|:  ::||     |..||:........:|:......|.:...|.|....|...:..:||:
Human   497 EEQMQGMKTQLIQ-----LSTLLRLLDSGFCSYLESQDSGYLYFCFRWLLIRFKREFSFLDILRL 556

  Fly   258 WDCFLAEGIRVIFKVALVIIGASLSRHKVRKTCTG----LCETLAVLRSPEEHIVEEEFIIN--- 315
            |:....|                       ..||.    ||  .|:|.|.::.|:|:.:..|   
Human   557 WEVMWTE-----------------------LPCTNFHLLLC--CAILESEKQQIMEKHYGFNEIL 596

  Fly   316 ---NMMRLNLRVEDF--QIEHTRQKARRAKQKAQQEAESSG 351
               |.:.:.:.|||.  :.|....:..:.|:..|...|..|
Human   597 KHINELSMKIDVEDILCKAEAISLQMVKCKELPQAVCEILG 637

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 38/171 (22%)
TBC1D15XP_006719627.1 DUF3548 19..227 CDD:192931
TBC 351..586 CDD:214540 57/264 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.