DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and TBC1D14

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_011511809.1 Gene:TBC1D14 / 57533 HGNCID:29246 Length:727 Species:Homo sapiens


Alignment Length:403 Identity:94/403 - (23%)
Similarity:154/403 - (38%) Gaps:138/403 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KEPLSKAQIIAREKKWL-------------------YMIDNW-SIYMSKNYKKIRDRCRKGIPKS 81
            |..|.:||   |.||.|                   .::.|| :::.|   :|:||...:|||.|
Human   347 KRELKEAQ---RRKKQLEERCRVEESIGNAVLTWNNEILPNWETMWCS---RKVRDLWWQGIPPS 405

  Fly    82 VRPKAWFYLSGAYLLKKKNPNVYNELL-----------------------EKPG-----NPTTIE 118
            ||.|.|....|..|      |:.:||.                       |..|     ...::|
Human   406 VRGKVWSLAIGNEL------NITHELFDICLARAKERWRSLSTGGSEVENEDAGFSAADREASLE 464

  Fly   119 EIKKDKHRQFP----FHEMFL------------------DEQKVGQI-----------ELFNVLK 150
            .||.|..|.||    |.::.:                  :..|:.|:           .|.::|.
Human   465 LIKLDISRTFPNLCIFQQVLIFVDFRVGLQKSFQKRKERESTKLQQLWSWCLGGPYHDMLHSILG 529

  Fly   151 AYSIYNPKVGFCQAQAPIAAFLLMHLPAEDAFWVFVSVCDVYLQDYFIPGLEVIQNDAGIL---- 211
            ||:.|.|.||:.|..:.|||.|:::|...|||..|.::.:...|..|      .:.|.|::    
Human   530 AYTCYRPDVGYVQGMSFIAAVLILNLDTADAFIAFSNLLNKPCQMAF------FRVDHGLMLTYF 588

  Fly   212 ---EGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFLAEGIRVIFKVA 273
               |...::..|.::.|.:|:.:.|.:|:.||.....:::||.:...|:||.|..:|...:|:.|
Human   589 AAFEVFFEENLPKLFAHFKKNNLTPDIYLIDWIFTLYSKSLPLDLACRIWDVFCRDGEEFLFRTA 653

  Fly   274 LVIIGASLSRHKVRKTCTGLCETLAVLRSPEEHIVEEEFIINNMMRLNLRV-EDFQIEH------ 331
                                   |.:|:..|:.:.:.:||  :|.:...|: ||...|.      
Human   654 -----------------------LGILKLFEDILTKMDFI--HMAQFLTRLPEDLPAEELFASIA 693

  Fly   332 TRQKARRAKQKAQ 344
            |.|...|.|:.||
Human   694 TIQMQSRNKKWAQ 706

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 49/202 (24%)
TBC1D14XP_011511809.1 TBC 398..664 CDD:214540 67/300 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.