DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and tbc1d9

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_692034.2 Gene:tbc1d9 / 563578 ZFINID:ZDB-GENE-060810-33 Length:1248 Species:Danio rerio


Alignment Length:268 Identity:85/268 - (31%)
Similarity:135/268 - (50%) Gaps:35/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RTDKPKEPLSK-AQIIAREKKW------------LYMIDNWSIYMSKNYKKIRDRCRKGIPKSVR 83
            |...|:|...| |:...:|:.|            :|..|           |.:|...:|||:::|
Zfish   466 RRRSPEEFNPKLAKEFLKEQAWKNHFTEYGQGVCMYRTD-----------KTKDLVLQGIPENMR 519

  Fly    84 PKAWFYLSGAYLLKKKNPNVYNELLEKPGNPTTI--EEIKKDKHRQFPFHEMFLDEQKVGQIELF 146
            .:.|...|||......:|..|.:|:||......:  |||::|.||..|.|..|.:|  :|...|.
Zfish   520 GELWLLFSGAINEMATHPGYYEDLVEKSMGKYNLATEEIERDLHRSLPEHPAFQNE--MGIAALR 582

  Fly   147 NVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAEDAFWVFVSVCDVYLQDYF---IPGLEVIQNDA 208
            .||.||:..||.:|:|||...:.:.||::...|:|||:.|::|:..|.||:   :.|..|   |.
Zfish   583 RVLTAYAFRNPNIGYCQAMNIVTSVLLLYAKEEEAFWLLVAMCERMLPDYYNTRVVGALV---DQ 644

  Fly   209 GILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFLAEGIRVIFKVA 273
            |:.|.|.....|.:|..:|...|...:.:: |||......:|:|:.:.|.|||..|||:|||::|
Zfish   645 GVFEELAHVHVPQLYDCMQALGVISTISLS-WFLTLFLSVMPFESAVVVVDCFFYEGIKVIFQLA 708

  Fly   274 LVIIGASL 281
            |.::.|::
Zfish   709 LSVLDANI 716

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 60/167 (36%)
tbc1d9XP_692034.2 PH-GRAM1_TCB1D9_TCB1D9B 154..252 CDD:275420
PH-GRAM2_TCB1D9_TCB1D9B 301..396 CDD:270161
TBC 510..720 CDD:214540 74/213 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.