DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and si:ch211-266k8.4

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_687788.5 Gene:si:ch211-266k8.4 / 559362 ZFINID:ZDB-GENE-131121-469 Length:617 Species:Danio rerio


Alignment Length:431 Identity:107/431 - (24%)
Similarity:171/431 - (39%) Gaps:100/431 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LDTISLCSTVSSC--PDRNGFYGGFQRTDKPKEPLSKAQIIAREKKWLYMIDNWSIYMSKNYKKI 70
            |..:|..|:..||  |.|.....||   |:.....||    .|:||......::| |...|..|:
Zfish     3 LRRVSSSSSGKSCNKPRRRSSSVGF---DEFGFAFSK----KRDKKLQQRCHDYS-YPQPNPVKV 59

  Fly    71 RDRC---------------------RKGIPKSVRPKAWFYLSGAYLLKKKNPNVYNELLEKPGNP 114
            ::.|                     |.|||.::|.:.|..|.....|:..:...|.:...:...|
Zfish    60 KELCEFLSYWNGSSFICRSQIERFIRIGIPPAIRGRVWRCLLNIDSLRATSCFNYEDCQSEIRRP 124

  Fly   115 --------------------------------------TTIEEIKKDKHRQFPFHEMFLDEQK-- 139
                                                  |..::|..|..|.||.|...:.::.  
Zfish   125 LVDLGVSEYSIISSIDSLVDTENEISSGQASSPQVADLTLFKQIALDLQRSFPTHRTLMGDRPEA 189

  Fly   140 -VGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAEDAFWVFVSVCD--VYLQDYFIPGL 201
             .||.:||.||.|::.|||.:|:.|..:.|||.|||.|..|:|||..|::.:  .||.:.|...:
Zfish   190 IEGQAKLFRVLSAFARYNPLIGYVQGMSYIAAVLLMILSEEEAFWALVALLEKPKYLSELFDSSM 254

  Fly   202 EVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFLAEGI 266
            :.||:.|.:...|||...|.:::||:...|..:.::..|||...|....|:::|.:||..:..|:
Zfish   255 KKIQHQALVFHQLLKHRKPLLFQHLETLGVSCVHFIMQWFLTLFTSLPCWDSVLAIWDLIMLHGL 319

  Fly   267 RVIFKVALVIIGASLSRHKVRKTCTGLCETLAV----LRSPEE---HIV---------EEEFIIN 315
            :.:|:..|.||....||      ...:.|...|    ||.|.:   |.|         .:|:.||
Zfish   320 QAVFRTGLTIILLLESR------IMNMTEEATVLPLLLRVPIDICHHRVLIPALWSTDLQEWEIN 378

  Fly   316 NMMRLNLRVEDFQIEHTRQKARRAKQKAQQEAESSGSGNGH 356
            .|..|.|.    :::.|:.:.:..|:..:....|...|..|
Zfish   379 CMNSLVLE----ELDSTQDEEKANKENTKISTASFSDGQLH 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 56/205 (27%)
si:ch211-266k8.4XP_687788.5 RabGAP-TBC 166..338 CDD:278964 58/177 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D976276at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.