DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and si:ch211-288d18.1

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_686696.2 Gene:si:ch211-288d18.1 / 558401 ZFINID:ZDB-GENE-060503-323 Length:603 Species:Danio rerio


Alignment Length:326 Identity:110/326 - (33%)
Similarity:163/326 - (50%) Gaps:25/326 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DRNGFYGGFQ-RTDKPKEPLSKAQIIAREKKWLYMIDNWSIYMSKNYKKIRDRCRKGIPKSVRPK 85
            ||.||....: .|....|...|...|.|.:|||.|:.|||.|  :|..::..|..||||..:|.:
Zfish    45 DRFGFLHEEELPTPSALEEKQKQVEIERVQKWLKMLKNWSKY--RNSDRMMKRVFKGIPLQLRGQ 107

  Fly    86 AWFYLSGAYLLKKKNPNVYNELLEKPG--NPTTIEEIKKDKHRQFPFHEMFLDEQKVGQIELFNV 148
            ||..|.....:|..|...|..:.|:..  :| .|::|..|.:|.|..|.||:|...|.|..||:|
Zfish   108 AWALLLDVEKVKSDNAGKYERMKEQAQLYSP-EIKQIDLDINRTFRNHIMFMDRFGVKQQSLFHV 171

  Fly   149 LKAYSIYNPKVGFCQAQAPIAAFLLMHLPAEDAFWVFVSVCDVY---LQDYFIPGLEVIQNDAGI 210
            |.|||:||.:|.:||..:.|||.|||.:..|||||....:....   :..:|:||...:|.....
Zfish   172 LSAYSVYNTEVSYCQGMSQIAAILLMFMNEEDAFWALSQLLTNQKHGMHGFFVPGFPKLQRFQNH 236

  Fly   211 LEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFL-CAMTRTLPWETLLRVWDCFLAEGIRVIFKVAL 274
            .:.:|.|..|.:.:||.|.::...:|.|.||| |.:.|| |:...||:||.|:.||.:|:..:|.
Zfish   237 HDQILSKLLPKLKKHLDKEQMSSGIYSTKWFLQCFINRT-PFTLTLRLWDIFILEGEKVLTAMAY 300

  Fly   275 VIIGASLSRHKVRKTCTGLCETLAVLRSPEEHIVEEEFIINNMMRLNLRVEDFQIEHTRQKARRA 339
            .|    |..||.|.    |..:|..||...:..:.|...:|:    :|.:|  |::.:..:.|:.
Zfish   301 TI----LQLHKKRL----LKMSLEELREFLQEKIGESIYLND----DLVIE--QLKVSMSELRKM 351

  Fly   340 K 340
            |
Zfish   352 K 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 63/166 (38%)
si:ch211-288d18.1XP_686696.2 TBC 98..311 CDD:214540 80/222 (36%)
DUF4688 <356..>444 CDD:292380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D976276at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.