DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and tbc1d14

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_005166496.1 Gene:tbc1d14 / 557744 ZFINID:ZDB-GENE-030131-6136 Length:711 Species:Danio rerio


Alignment Length:372 Identity:85/372 - (22%)
Similarity:137/372 - (36%) Gaps:126/372 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KPKEPLSK-----AQIIAREKK-----------------------------WLY-MIDNWSIYMS 64
            ||:|...|     .:::|:.||                             |.. ::.||....|
Zfish   345 KPEEEAQKHRQQYEEMVAQAKKRELKDAQKRKKQLEDRCKLEESIGNAALTWSQEILPNWQSMCS 409

  Fly    65 KNYKKIRDRCRKGIPKSVRPKAWFYLSGAYLLKKKNPNVYNEL---------------------- 107
            .  |::||...:|:|.|||.|.|....|..|      |:.:||                      
Zfish   410 S--KRVRDLWWQGLPPSVRGKVWSLAIGNEL------NITDELYDICLARAKEKWNAFVAPTAAV 466

  Fly   108 --------LEKPGNPTTIEEIKKDKHRQFPFHEMFLDEQKVGQIE--LFNVLKAYSIYNPKVGFC 162
                    |.......::|.||.|..|.||...:|   ||.|...  |.::|.||:.|.|.||:.
Zfish   467 ETESEDAGLSHADREASLELIKLDISRTFPNLCIF---QKGGPYHDVLHSILGAYTCYRPDVGYV 528

  Fly   163 QAQAPIAAFLLMHLPAEDAFWVFVSV----CDV--YLQD------YFIPGLEVIQNDAGILEGLL 215
            |..:.|||.|:::|...|||..|.::    |.:  |..|      ||           ...|...
Zfish   529 QGMSFIAAVLILNLDTADAFIAFANLLNKPCQMAFYRVDHSLMLTYF-----------AAFEVFF 582

  Fly   216 KKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFLAEGIRVIFKVALVIIGAS 280
            ::..|.::.|.:.:.:...:|:.||.....:::||.:...||||.|..:|...:|:.|       
Zfish   583 EENLPKLFAHFKNNNLSSDIYLIDWIFTLYSKSLPLDIACRVWDVFCRDGEEFLFRTA------- 640

  Fly   281 LSRHKVRKTCTGLCETLAVLRSPEEHIVEEEFIINNMMRLNLRVEDF 327
                            |.:||..|:.:...:||  ::.:...|:.|:
Zfish   641 ----------------LGILRLYEDILTHMDFI--HIAQFLTRLPDY 669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 50/176 (28%)
tbc1d14XP_005166496.1 COG5210 293..656 CDD:227535 81/355 (23%)
RabGAP-TBC 485..651 CDD:278964 54/202 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.