DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and tbc1d10b

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001352184.1 Gene:tbc1d10b / 556457 ZFINID:ZDB-GENE-030131-7754 Length:860 Species:Danio rerio


Alignment Length:362 Identity:147/362 - (40%)
Similarity:213/362 - (58%) Gaps:32/362 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DRNGFYGGFQRTD-----------KPKEPLSKAQIIAREKKWLYMIDNWSIYMSKNYKKIRDRCR 75
            |:.||.||.|.::           ..:..|:.|....||.|||.|..||..::|:.::|::.|||
Zfish   268 DKYGFLGGAQYSETKHCAGSGPNLNSEAELAVAVARQREMKWLDMFRNWDKWVSRRFQKVKMRCR 332

  Fly    76 KGIPKSVRPKAWFYLSGAYLLKKKNPNVYNELLEKPGNPTTIEEIKKDKHRQFPFHEMFLDEQKV 140
            ||||.|:|.|||..||.:..|...||..:.||.::.|:|..::.|:||.||||||||||......
Zfish   333 KGIPSSLRAKAWQLLSNSQELLDSNPGKFEELEQEQGDPKWLDIIEKDLHRQFPFHEMFAARGGH 397

  Fly   141 GQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAEDAFWVFVSVCDVYLQDYFIPGLEVIQ 205
            ||.:|:.:||||::|.|..|:||||||:||.||||:|||.|||..|.:|:.:|..|:..|||.||
Zfish   398 GQQDLYRILKAYTVYRPDEGYCQAQAPVAAVLLMHMPAEQAFWCLVQICEKFLPGYYSAGLEAIQ 462

  Fly   206 NDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFLAEGIRVIF 270
            .|..|...||::.||..||||:|.|::|:||||:||:|..:|||||..:|||||.|..||::::|
Zfish   463 LDGEIFFSLLRRVCPMAYRHLKKFKIDPILYMTEWFMCIFSRTLPWSCVLRVWDMFFCEGVKIVF 527

  Fly   271 KVALVIIGASLSRHKVRKTCTGLCETLAVLRSPEEHIVEEEFIINNMMRLNL------RVEDFQI 329
            :|.||::...|......:...|:.||:..||:.....::|:.::..::.|::      |....|:
Zfish   528 RVGLVLLKQMLGSVDKLRELQGMYETMDRLRNIPPESIKEDVLVQEVISLSVTEALIERECSIQV 592

  Fly   330 --------EHTRQKARRA-------KQKAQQEAESSG 351
                    |.|.|..||.       :||.:..|.|||
Zfish   593 RKWRESRGELTHQPVRRLHGTRAIYEQKQRAAAISSG 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 88/162 (54%)
tbc1d10bNP_001352184.1 Atrophin-1 <8..241 CDD:331285
TBC 331..536 CDD:214540 107/204 (52%)
Atrophin-1 <609..775 CDD:331285 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 247 1.000 Domainoid score I2118
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001498
OrthoInspector 1 1.000 - - otm25978
orthoMCL 1 0.900 - - OOG6_104218
Panther 1 1.100 - - LDO PTHR22957
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 1 1.000 - - X1223
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.940

Return to query results.
Submit another query.