DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and tbc1d25

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001121708.1 Gene:tbc1d25 / 556338 ZFINID:ZDB-GENE-041111-25 Length:863 Species:Danio rerio


Alignment Length:376 Identity:79/376 - (21%)
Similarity:137/376 - (36%) Gaps:90/376 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TISLCSTVSSCPDR-----NGFYGGFQRTDKPKEPLSKAQIIAREKKWLYMIDNWSIYMSKNY-- 67
            |.||.|.|.....|     :..||...:..||  |||.|:.                   .||  
Zfish   139 TQSLLSQVGRTLSRVQQALSWSYGEEVKPFKP--PLSDAEF-------------------HNYLN 182

  Fly    68 --------KKIRDRC-RKGIPKSVRPKAWFYLSGAY-----------LLKKKNPNVYNELLEKPG 112
                    :::|.|. ..|:..|:|...|.||...|           .:|:|. ..|::|..:..
Zfish   183 SQGQLSRPEELRLRIYHGGVESSLRKVVWRYLLNVYPDGLTGQERMDYMKRKT-REYDQLKSEWT 246

  Fly   113 NPTTIEEIK-------KDKHRQFPFHEMFL-DEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIA 169
            ...:.||::       ||..|....|..:. .|.......|.::|..::|.:|:|.:||..:.||
Zfish   247 ARVSSEELEFIRGNVLKDVLRTDRAHPYYAGSEDSPHLTALTDLLTTFAITHPQVSYCQGMSDIA 311

  Fly   170 AFLLMHLPAEDAFWVFVSVCDVY--LQDYFIPGLEVIQNDAGILEGLLKKTCPPVYRHLQKHKVE 232
            :.:|..:  ::....|:..|.:.  |:..|.|..:::......|:.||:.:.|..|.:|.....:
Zfish   312 SPILAVM--DNEAHAFICFCGIMKRLEGNFRPDGQLMSIKFQHLKLLLQYSDPEFYSYLVSKGAD 374

  Fly   233 PLLYMTDWFLCAMTRTLPWETLLRVWDCFLAEGIRVIFKVALVIIGASLSRHKVRKTCTGLCETL 297
            .|.:...|.|..:.|...::..||:                |.:..:||...........|....
Zfish   375 DLFFCYRWLLLELKREFAFDDALRM----------------LEVTWSSLPPDPPETEVELLGPAF 423

  Fly   298 AVLRSPEEHIVEEEFIINNMMRLNLRVEDFQIEHTRQKARRAKQKAQQEAE 348
            ...:|...|.|:.|           .:|:.|.|  ||:.|...:.:::||:
Zfish   424 EADQSDGSHNVDME-----------EMEEKQTE--RQRRRHMLRPSREEAD 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 35/172 (20%)
tbc1d25NP_001121708.1 TBC 198..420 CDD:214540 48/240 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.