DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and TBC1D2

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001254500.1 Gene:TBC1D2 / 55357 HGNCID:18026 Length:928 Species:Homo sapiens


Alignment Length:352 Identity:99/352 - (28%)
Similarity:159/352 - (45%) Gaps:43/352 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LDTISLCSTVSSCPDRNGFYGGFQRTDKPKEPLSKAQIIAREKKWLYMIDNWSIYMSKNYKKIRD 72
            ::.:.|.:.:.:...|:....|.:..|:|          .|| :|..:.|   :..|...|::  
Human   573 VEDLKLLAKIQALESRSHHLLGLEAVDRP----------LRE-RWAALGD---LVPSAELKQL-- 621

  Fly    73 RCRKGIPKSVRPKAWFYLSGAYLLKKKNPNVYNELL------EKPGNPTTIEEIKKDKHRQFPFH 131
             .|.|:|:..||:.|.:|....:.....|..|.|||      |.|    ...:|:.|.:|.||.:
Human   622 -LRAGVPREHRPRVWRWLVHLRVQHLHTPGCYQELLSRGQAREHP----AARQIELDLNRTFPNN 681

  Fly   132 EMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAED-AFWVFVSVCDVYL-Q 194
            :.|.........:|..||.|:|..||.:|:||....:||..|:.|..|: |||..|::.:..: .
Human   682 KHFTCPTSSFPDKLRRVLLAFSWQNPTIGYCQGLNRLAAIALLVLEEEESAFWCLVAIVETIMPA 746

  Fly   195 DYFIPGLEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWD 259
            ||:...|...|.|..:|:.||.:..|.:..||.:|.|:..|...:|||.....:|....||||||
Human   747 DYYCNTLTASQVDQRVLQDLLSEKLPRLMAHLGQHHVDLSLVTFNWFLVVFADSLISNILLRVWD 811

  Fly   260 CFLAEGIRVIFKVALVIIGASLSRHKVRKTCTGLCETLAVLRSPEEHIVEEEFIINNMMRLNLRV 324
            .||.||.:|:|:.||.|.  ..:..::.:...|| |....||      ...:.|.|:...:|:..
Human   812 AFLYEGTKVVFRYALAIF--KYNEKEILRLQNGL-EIYQYLR------FFTKTISNSRKLMNIAF 867

  Fly   325 ED---FQIEHTRQKARRAKQKAQQEAE 348
            .|   |:::..||  .|...:.:.|||
Human   868 NDMNPFRMKQLRQ--LRMVHRERLEAE 892

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 57/164 (35%)
TBC1D2NP_001254500.1 Interaction with CADH1 1..169
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39
PH_TBC1D2A 47..147 CDD:269966
PH 47..139 CDD:278594
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 225..275
Interaction with RAC1. /evidence=ECO:0000269|PubMed:20116244 295..433
TBC 625..837 CDD:214540 71/217 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.