DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and grtp1b

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001017810.1 Gene:grtp1b / 550508 ZFINID:ZDB-GENE-050417-346 Length:349 Species:Danio rerio


Alignment Length:276 Identity:94/276 - (34%)
Similarity:142/276 - (51%) Gaps:11/276 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GFQRTDKPKEPLSK------AQIIAREKKWLYMIDNWSIYMSKNYKKIRDRCRKGIPKSVRPKAW 87
            ||:::|...|...:      |.:..|.|||..::.... .|.||. |::...|||||...|.:.|
Zfish    27 GFEKSDFNYESYEELMSDYLAVVTRRSKKWSKLLQGTG-KMEKNL-KVKRYVRKGIPCEHRTEIW 89

  Fly    88 FYLSGAYLLKKKNPNVYNELLEKPGNPTTIEE-IKKDKHRQFPFHEMFL-DEQKVGQIELFNVLK 150
            ...|||....::||..|..||:...:...||| |..|.||.||.:..|. ..|...|..|||||.
Zfish    90 MAFSGAQDQLERNPGYYQALLKTEQHDPKIEEVIHADMHRTFPDNIQFRHSSQSCLQKALFNVLL 154

  Fly   151 AYSIYNPKVGFCQAQAPIAAFLLMHLPAED-AFWVFVSVCDVYLQDYFIPGLEVIQNDAGILEGL 214
            ||..:|..||:||....||.:||:....|: :||:.|::....|.||:...:..::.|..:|..|
Zfish   155 AYGHHNKDVGYCQGMNFIAGYLLIITKDEEKSFWLMVALIGRILPDYYTQTMLGLKVDQEVLGEL 219

  Fly   215 LKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFLAEGIRVIFKVALVIIGA 279
            :|...|.|::.:.:|.|...|.::.||:|.....||.||:||:|||...||.:::|:|||.:|..
Zfish   220 VKSKVPAVWQTMNQHDVMWTLVVSRWFICLYVDVLPVETVLRIWDCLFYEGSKILFRVALTLIRH 284

  Fly   280 SLSRHKVRKTCTGLCE 295
            :.:.....|:...:||
Zfish   285 NQNLISQAKSLPEICE 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 62/165 (38%)
grtp1bNP_001017810.1 TBC 76..289 CDD:214540 78/212 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.