DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and TBC1D8B

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_060222.2 Gene:TBC1D8B / 54885 HGNCID:24715 Length:1120 Species:Homo sapiens


Alignment Length:299 Identity:89/299 - (29%)
Similarity:140/299 - (46%) Gaps:42/299 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 NWSIYMSK--------NYKKIRDRCRKGIPKSVRPKAWFYLSGAYLLKKKNPNVYNELLEKPGNP 114
            :|.|..::        ..||.||...:|||:::|.:.|...|||......||:.|.|::|:....
Human   460 SWKILFAECGRGVSMFRTKKTRDLVVRGIPETLRGELWMLFSGAVNDMATNPDYYTEVVEQSLGT 524

  Fly   115 TTI--EEIKKDKHRQFPFHEMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLP 177
            ..:  |||::|..|..|.|..|  :...|...|..||.||:..|||:|:|||...:.:.||::..
Human   525 CNLATEEIERDLRRSLPEHPAF--QSDTGISALRRVLTAYAYRNPKIGYCQAMNILTSVLLLYAK 587

  Fly   178 AEDAFWVFVSVCDVYLQDYF---IPGLEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTD 239
            .|:|||:.|:||:..|.|||   |.|..|   |..:.|.|::...|.:..|           |||
Human   588 EEEAFWLLVAVCERMLPDYFNRRIIGALV---DQAVFEELIRDHLPQLTEH-----------MTD 638

  Fly   240 ----------WFLCAMTRTLPWETLLRVWDCFLAEGIRVIFKVALVIIGASLSRHKVRKTCTGLC 294
                      |||......||.|:.:.|.|||..:||:.|.::.|.|:..:|.:   ..||....
Human   639 MTFFSSVSLSWFLTLFISVLPIESAVNVVDCFFYDGIKAILQLGLAILDYNLDK---LLTCKDDA 700

  Fly   295 ETLAVLRSPEEHIVEEEFIINNMMRLNLRVEDFQIEHTR 333
            |.:..|....:::..::..:.:.::....|.|.:..|||
Human   701 EAVTALNRFFDNVTNKDSPLPSNVQQGSNVSDEKTSHTR 739

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 59/177 (33%)
TBC1D8BNP_060222.2 PH-GRAM1_TBC1D8B 156..254 CDD:275419
PH-GRAM2_TBC1D8B 296..388 CDD:270159
TBC 486..694 CDD:214540 74/226 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1035..1066
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.