DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and TBC1D13

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_060671.3 Gene:TBC1D13 / 54662 HGNCID:25571 Length:400 Species:Homo sapiens


Alignment Length:359 Identity:70/359 - (19%)
Similarity:117/359 - (32%) Gaps:131/359 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 CPDRNGFYGGFQR-TDKP------------------KEPLSKAQIIAREKKWLYMIDNWSIYMSK 65
            |||    ...||| ||.|                  ::...|:|.:||.                
Human   131 CPD----ISFFQRATDYPCLLILDPQNEFETLRKRVEQTTLKSQTVARN---------------- 175

  Fly    66 NYKKIRDRCRKGIPKSVRPKAWFYLSGAYLLKKKNPNVYNELLEKPGNPTTIEEIKKDKHRQFPF 130
                     |.|:.....|.           |...|:..||....|.......|:.:        
Human   176 ---------RSGVTNMSSPH-----------KNSVPSSLNEYEVLPNGCEAHWEVVE-------- 212

  Fly   131 HEMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLM------------HLPAEDAFW 183
                            .:|..|:..||.:.:.|....|...|..            |..| |.|:
Human   213 ----------------RILFIYAKLNPGIAYVQGMNEIVGPLYYTFATDPNSEWKEHAEA-DTFF 260

  Fly   184 VFVSVCDVYLQDYFIPGLEVIQNDAGI------LEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFL 242
            .|.::. ..::|.||..|:  .:..||      :...||.....:|..||:..::|..:...|..
Human   261 CFTNLM-AEIRDNFIKSLD--DSQCGITYKMEKVYSTLKDKDVELYLKLQEQNIKPQFFAFRWLT 322

  Fly   243 CAMTRTLPWETLLRVWDCFLAEGIRVIFKVALVIIGASLSRHKVRKTCTGLCETLAVLRSPEEHI 307
            ..:::......::|:||...|:..|..|   |:::            |   |..|.::|   |.:
Human   323 LLLSQEFLLPDVIRIWDSLFADDNRFDF---LLLV------------C---CAMLMLIR---EQL 366

  Fly   308 VEEEFIINNMMRLNLRVEDFQIEHTRQKARRAKQ 341
            :|.:|.:|  |||   ::|:.|....|..::||:
Human   367 LEGDFTVN--MRL---LQDYPITDVCQILQKAKE 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 33/180 (18%)
TBC1D13NP_060671.3 TBC 32..367 CDD:214540 59/324 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.