DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and Tbc1d5

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_008764990.1 Gene:Tbc1d5 / 501088 RGDID:1561626 Length:827 Species:Rattus norvegicus


Alignment Length:412 Identity:93/412 - (22%)
Similarity:145/412 - (35%) Gaps:125/412 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PLSKAQIIAREKKWLYMIDNWSIYMSKNYKKIRDRCRKGIPKSVRPKAWFYLSGAYLLKKKNP-- 101
            |..|:|.|:|.|:    :.:|    ..|.|:|.         ...|:.   :.|...|...||  
  Rat    99 PQDKSQWISRIKE----LRSW----YSNIKEIH---------ITNPRK---VVGQQDLMINNPLS 143

  Fly   102 ----NVYNELLEKPGNPTTIEEIKKDKHRQFPFHEM-FLDEQKVGQIELFNVLKAYSIYNP---- 157
                :::|:..:.....:.||:   |..|.||  || |..::.|.:| |.:||..|:..|.    
  Rat   144 QDEGSLWNKFFQDKELRSMIEQ---DVRRTFP--EMQFFQQENVRKI-LTDVLFCYARENEQLLY 202

  Fly   158 KVGFCQAQAPI--------AAFLLMHL-----PAE-------------DAFWVFVSVCDVYLQDY 196
            |.|..:..|||        .|||  |.     |:|             ||:.:|..:.:. .:.:
  Rat   203 KQGMHELLAPIIFTLHCDHQAFL--HASESAQPSEEMKTLLNPEYLEHDAYAMFSQLMET-AEPW 264

  Fly   197 FI--------------------------PGLEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLL 235
            |.                          |.:.::.....|.:.||||....:|.||.:.::.|.:
  Rat   265 FSTFEHDGQKGKETLMPPIPFARPQDLGPTVAIVTKVNQIQDHLLKKHDTELYMHLNRLEIPPQI 329

  Fly   236 YMTDWFLCAMTRTLPWETLLRVWDCFLAEGIRV-----IFKVALVIIGASLSRHKVRKTCTGL-- 293
            |...|......|..|.:.||.|||...|:|:.:     :|...|:.|..:|..... :||.||  
  Rat   330 YGLRWVRLLFGREFPLQDLLVVWDALFADGLHLSLVDYVFTAMLLYIRDALISSNY-QTCLGLLM 393

  Fly   294 -------CETLAV----LRSPEEH--IVEEEFIIN------------NMMRLNLRVEDFQIEHTR 333
                   ..:|.:    ||.|:.:  .|..:|..|            |..|.|.|.....|....
  Rat   394 HYPLIGDIHSLILKALFLRDPKRNPRPVTYQFHPNLDYYKARGADLMNKSRTNARGAPLNIHKVS 458

  Fly   334 QKARRAKQKAQQEAESSGSGNG 355
            .......:|....|.:.||..|
  Rat   459 NSLINFGRKLIAPASAPGSMGG 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 54/224 (24%)
Tbc1d5XP_008764990.1 TBC 79..381 CDD:214540 71/310 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.