DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and tbc1d15

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_005159143.1 Gene:tbc1d15 / 492676 ZFINID:ZDB-GENE-041111-251 Length:665 Species:Danio rerio


Alignment Length:320 Identity:65/320 - (20%)
Similarity:121/320 - (37%) Gaps:85/320 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 IDNWSIYMS-----KNYKKIRDRCRK-GIPKSVRPKAWFYLSGAY----------LLKKKNPNV- 103
            ::.|:.|..     .|...::|...| |:..:||.:||.:|.|.:          ||:|:..:. 
Zfish   298 MEEWAKYQDLEGRMTNLPHLKDAIFKGGLCHAVRKEAWKFLLGYFPWSSTHEERKLLQKRKTDEY 362

  Fly   104 -----------------------YNELLEKPGNPTTIEEIKKDKHRQFPFHEMFLDEQKVGQIEL 145
                                   |..|:||..|.|       |::.:|     :......|.|.|
Zfish   363 FRMKLQWKSVSEEQERRNSRLRDYRSLIEKDVNRT-------DRNNKF-----YEGLDNPGLILL 415

  Fly   146 FNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAE-DAFWVFVSVCDVYLQDYFIPGLEVIQNDAG 209
            .::|..|.:|:..:|:.|..:.:.:.:|..:..| ||||.|||..| .:.:.|...::.::....
Zfish   416 HDILMTYCMYDFDLGYVQGMSDLLSPILFVMENEVDAFWCFVSFMD-EMHENFEEQMQGMKTQLI 479

  Fly   210 ILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFLAEGIRVIFKVAL 274
            .|..||:......:.:|:......|.:...|.|....|.|.::.:||:|:...            
Zfish   480 QLSTLLRLLDLAFWNYLEAQDSGYLYFCFRWLLIRFKRELHFQDVLRLWEVMW------------ 532

  Fly   275 VIIGASLSRHKVRKTCTG--LCETLAVLRSPEEHIVEEEFIIN------NMMRLNLRVED 326
                       .|..|..  |....|:|.|.::.|::.::..|      |.:.:.|.:|:
Zfish   533 -----------TRLPCQNFHLLVCCAILDSEKQKIMDRKYGFNEILKHINELSMKLDIEE 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 34/163 (21%)
tbc1d15XP_005159143.1 DUF3548 4..220 CDD:192931
TBC 322..557 CDD:214540 56/270 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.