DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and tbc1d16

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001006076.2 Gene:tbc1d16 / 450056 ZFINID:ZDB-GENE-041010-179 Length:717 Species:Danio rerio


Alignment Length:271 Identity:60/271 - (22%)
Similarity:114/271 - (42%) Gaps:36/271 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PKEPLSKAQIIAREKKWLYMIDNWSIYMSKNYKKIRDRCRKGIPKSVRPKAWFYLSGAYLLKKKN 100
            |:|.|.:...::   .||..::| |..:.:.||..:.....||..|:|.:.|.:|...|.....:
Zfish   332 PEERLYRRLDVS---SWLRHLNN-SGQVLEEYKLRKAIFFGGIDPSIRGEVWPFLLHYYSYDSTS 392

  Fly   101 PNVYNELLEKPGNPTTIEE----IKKDKHRQF---------------PFHEMFLDEQKVGQIELF 146
            .......|:|.|....|::    :..::|.:|               ....||...:....:|:.
Zfish   393 EEREAWRLQKRGEYQDIQQRRLSMSPEEHSEFWRKVQFTVDKDVVRTDRSNMFFRGENNPNVEIM 457

  Fly   147 -NVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAE-DAFWVFVSVCD--VYLQDYFIPGLEVIQND 207
             .:|..|:::||.:|:||..:.:.|.||..:..| |.||.||.:.:  :::..   |..|.::..
Zfish   458 RRILLNYAVFNPDMGYCQGMSDLVAPLLTEIQDESDTFWCFVGLMENTIFISS---PRDEDMERQ 519

  Fly   208 AGILEGLLKKTCPPVYRHLQKHKVE--PLLYMTDWFLCAMTRTLPWETLLRVWDC----FLAEGI 266
            ...|..||:...|..::||.:...:  .||:...|.|....|..|....||:|:.    :..:..
Zfish   520 LMYLRELLRLMLPRFHQHLTRLGEDGLQLLFCHRWVLLCFKREFPDAEALRMWEACWAHYQTDYF 584

  Fly   267 RVIFKVALVII 277
            .:...||::::
Zfish   585 HLFLCVAIIVL 595

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 41/191 (21%)
tbc1d16NP_001006076.2 TBC 368..596 CDD:214540 51/231 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.