DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and grtp1

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001005632.1 Gene:grtp1 / 448089 XenbaseID:XB-GENE-950226 Length:342 Species:Xenopus tropicalis


Alignment Length:344 Identity:100/344 - (29%)
Similarity:165/344 - (47%) Gaps:28/344 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SCPDRNGFYGGFQRTDK-----PKEPLSKAQII--AREKKWLYMIDNWSIYMSKNYKKIRDRCRK 76
            |.|..:|:  ||.|..:     .:|.:::..::  .|..||..::.. |..:.|| .|::...||
 Frog    11 SVPRIDGY--GFVRPAEFDYAFYEEFIARYHVVLTRRAIKWSKLLQQ-SAAVEKN-MKVKRYIRK 71

  Fly    77 GIPKSVRPKAWFYLSGAYLLKKKNPNVYNELL-EKPGNPTTIEEIKKDKHRQFPFHEMFLDEQKV 140
            |||...|...|..:|||......|...:..:. |...||..::.:..|.:|.||.:.:|   ||.
 Frog    72 GIPNEHRSHVWMVVSGAQAQMDMNTGYFRRMFTEGEKNPKLLDLVITDLNRTFPDNVLF---QKN 133

  Fly   141 G----QIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAED-AFWVFVSVCDVYLQDYFIPG 200
            .    |.:|:|||.||..:|..||:||....||.:|::....|: |||:..::....|.||:.|.
 Frog   134 ANPSLQKDLYNVLVAYGQHNKTVGYCQGMNFIAGYLILVTKDEEKAFWLMDALIGQILPDYYSPA 198

  Fly   201 LEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFLAEG 265
            :..::.|..:|..|:||..|.|.:.::.|.|...|.::.||:|.....||.||:||:|||...||
 Frog   199 MTGLKTDQEVLGDLVKKKIPSVAQLIETHGVMWTLLVSRWFICLFIDILPVETVLRIWDCLFFEG 263

  Fly   266 IRVIFKVALVIIGASLSRHKVRKTCTGLCETLAVLRSPEEHIVEEEFIIN-NMMRLNLRVEDFQI 329
            .:|||:|||.:|..|.:.....:....:|:..       :.|.:.||:.: :.....:..|...:
 Frog   264 SKVIFRVALTLIKQSQASIMEARNFPDICDKF-------KEITKGEFVTDCHYFMQKIFAEPGSL 321

  Fly   330 EHTRQKARRAKQKAQQEAE 348
            ..|.....|.||:.:..:|
 Frog   322 SKTTIDKLREKQRLKLISE 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 61/167 (37%)
grtp1NP_001005632.1 TBC 69..283 CDD:214540 76/216 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.