DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and TBC1D5

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_731780.1 Gene:TBC1D5 / 41628 FlyBaseID:FBgn0038129 Length:654 Species:Drosophila melanogaster


Alignment Length:280 Identity:57/280 - (20%)
Similarity:101/280 - (36%) Gaps:67/280 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 LKKKNPNVYNELLEKPGNPTTIEEIKKDKHRQFPFHEMFLDEQKVGQIELFNVLKAYSIYNP--- 157
            |.:...:|:|:..   .:......|::|..|.||..:.|  .:.:.|..:.|:|..|:..:|   
  Fly   129 LSQSTQSVWNQYF---SDQDLFAVIRQDVVRTFPGVDFF--RKPLVQNAMVNILFYYAREHPYMC 188

  Fly   158 -KVGFCQAQAPIAAFL------LMH---LPAEDAFWVFVSVCD-VYL---------------QDY 196
             :.|..:..|||...:      |:|   |...|.....:.|.| .||               :.|
  Fly   189 YRQGMHEILAPIIFVVYSDHQSLLHFSELAKTDINPTLLDVLDPAYLEADTYSLFSRLMASVESY 253

  Fly   197 F-------IPG------------------LEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLY 236
            :       .||                  .|||.....|.:.:|.|....::.:|||.::...::
  Fly   254 YRVSNLVSTPGGHIEQRAESPGDNETSTEAEVIGQLNFIRDKILAKQDQHLHHYLQKMEIPLHIF 318

  Fly   237 MTDWFLCAMTRTLPWETLLRVWDCFLAEGIRVIFKVALVIIGASLSRHKVRKTCTGLCETLA-VL 300
            ...|......|......||.:||...|:..|  |.:...|:.|.|...:.:...:....:|. ::
  Fly   319 GIRWLRLLFGREFMLLDLLLLWDAIFADSDR--FDLPNYILVAMLVHIRDKLLLSDYTTSLTYLM 381

  Fly   301 RSP---EEHIVEEE--FIIN 315
            |.|   :.|:|...  |::|
  Fly   382 RYPNNVDVHLVLRHALFMLN 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 44/216 (20%)
TBC1D5NP_731780.1 TBC <150..369 CDD:214540 47/222 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456537
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.