DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and CG42795

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001287272.1 Gene:CG42795 / 41252 FlyBaseID:FBgn0261928 Length:3213 Species:Drosophila melanogaster


Alignment Length:382 Identity:97/382 - (25%)
Similarity:147/382 - (38%) Gaps:95/382 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TAPRSLDTISLCSTVSSCPDRNGFYGGFQRTDKPKEPLSKAQIIAREK------KWLYMIDNWSI 61
            |.|.| :..|..||.::...|||...|...|.........|...|.::      :||:.:     
  Fly   154 TTPGS-NNRSPSSTKTTMLTRNGGGHGTSPTASGSGHAPSATAAADDEATSDYNQWLHAM----- 212

  Fly    62 YMSKNYKKIRDRCRKGIPKSVRPKAWFYLSGAYLLKKKNPN-----------VYNELLEKPGNPT 115
                   |:..|...|.|...|.|.|..|:..| ||.||.:           .:.|..|:.|   
  Fly   213 -------KLVARLPGGTPPEFRRKLWLSLADKY-LKSKNVDWAQQREKCFCEEWREDDEELG--- 266

  Fly   116 TIEEIKKDKHR------QFPFHEMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLL- 173
              .:|.||.||      ..|       ...:.|.:|..:|..|:.|||:||:||....:.|.:| 
  Fly   267 --IQIVKDLHRTGSNLCTGP-------AGSINQAKLKRILLGYARYNPEVGYCQGFNMLGALILQ 322

  Fly   174 -MHLPAEDAFWVFVSVCD-VYLQDYFIPGLEVIQNDAGILEGLLKKTCPPVYRHLQK------HK 230
             |....|::..|.:.:.: |....||...:..:|.|.|:...|::...|.:.:|||:      :.
  Fly   323 VMDKEEEESMKVMIYLVEGVLPTGYFYGSMGGLQADMGVFRELMQTRLPRLAKHLQRLQGPVENA 387

  Fly   231 VEPLL---YMTDWFLCAMTRTLPWETLLRVWDCFLAEGIRVIFKVALVIIGASLSRHKVRKTCTG 292
            .||.|   :...|||......||...:|||||..|.||..|:.:.|||:...             
  Fly   388 FEPPLTNVFTMQWFLTMFCTCLPMSCVLRVWDLVLIEGSDVLLRTALVLWSL------------- 439

  Fly   293 LCETLAVLRSPEE---------------HIVEEEFIINNMMRLNLRVEDFQIEHTRQ 334
            |.|.:..:||.:|               |:|:...:|..:::|.      .||..||
  Fly   440 LEERVISVRSADEFYGKMGSYSSELLNGHLVDSNGLIERVVKLG------PIEDLRQ 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 53/180 (29%)
CG42795NP_001287272.1 RabGAP-TBC 268..443 CDD:278964 54/194 (28%)
DUF4682 560..684 CDD:292361
DBP 1112..1415 CDD:289157
SWIRM-assoc_2 <2376..2482 CDD:293105
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456597
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D74517at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.