DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and CG7324

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_649305.1 Gene:CG7324 / 40361 FlyBaseID:FBgn0037074 Length:1291 Species:Drosophila melanogaster


Alignment Length:274 Identity:83/274 - (30%)
Similarity:140/274 - (51%) Gaps:25/274 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 KGIPKSVRPKAWFYLSGAYLLKKKNPNVYNELLEKPG---NPTTIEEIKKDKHRQFPFHEMFLDE 137
            :|||..:|.:.|...|||...|:.||.:|.:|:||..   |....:||.:|..|..|.|..|...
  Fly   461 EGIPDKLRQEIWLIFSGAIHDKEMNPGLYEDLVEKAACIKNCFAHDEIDRDLPRSLPEHPAFQST 525

  Fly   138 QKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAEDAFWVFVSVCDVYLQDYFIPGLE 202
            ..:|.:.  .||:||::.||:||:|||...:::..|:....|:|||:..|:|:..|.||:...:.
  Fly   526 DGIGALR--RVLQAYALRNPQVGYCQAMNIVSSVFLLFCDEENAFWMLASLCENLLPDYYKDKVV 588

  Fly   203 VIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWETLLRVWDCFLAEGIR 267
            ..|.|.|:|..|::...|.::.||::..|..::.:: |||......:.:|:.|.:.|||..||.:
  Fly   589 GAQIDQGVLNELVETHLPDLHGHLEQLGVIKMISIS-WFLTIFMSVISYESSLHILDCFFYEGAK 652

  Fly   268 VIFKVALVIIGASLSRHKVRKTCTGLCETLAVLRSPEEHIVEEEFIINNMMRLNLRVEDFQIEHT 332
            :||.::|.||  ..:|.|: ..|....|.:.||::..|.:...|               :|:..|
  Fly   653 IIFMISLQII--EWNRDKL-LICQDDGEAMLVLQNYLEGVYNPE---------------YQVPPT 699

  Fly   333 RQKARRAKQKAQQE 346
            ..| |:.::|.|.:
  Fly   700 TDK-RKMERKVQTQ 712

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 51/162 (31%)
CG7324NP_649305.1 PH-GRAM1_TCB1D8_TCB1D9_family 147..249 CDD:275404
PH-GRAM2_TCB1D9_TCB1D9B 293..389 CDD:270161
TBC 462..670 CDD:214540 71/213 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456630
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D74517at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.