DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and tbc1d5

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001315187.1 Gene:tbc1d5 / 393583 ZFINID:ZDB-GENE-040426-1197 Length:863 Species:Danio rerio


Alignment Length:324 Identity:68/324 - (20%)
Similarity:117/324 - (36%) Gaps:100/324 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PLSKAQIIAREKKWLYMIDNWSIYMSKNYKKIRDRCRKGIPKSVRPKAWFYLSGAYLLKKKNP-- 101
            |..|||.|:|.|:           ....|:||::.      ....|:.   .:|...|...||  
Zfish    91 PEDKAQWISRTKE-----------HRAQYEKIKEM------HITNPRK---AAGQQDLVVNNPLS 135

  Fly   102 ----NVYNELLEKPGNPTTIEE----IKKDKHRQFPFHEMFLDEQKVGQIELFNVLKAYSIYNP- 157
                :::|:..:.       :|    ||:|..|.||  ||...:::..:.::.::|..|:..|. 
Zfish   136 QDEGSLWNKFFQD-------KELRGMIKQDVLRTFP--EMLYFQEEDVRTKMTDILFCYARENEQ 191

  Fly   158 ---KVGFCQAQAPIAAFL------LMHL-----PAE-------------DAFWVFVSVCDVYLQD 195
               |.|..:..|||...|      ..|.     |::             ||:.:|..:.:. .:.
Zfish   192 LLYKQGMHELLAPIVFVLHCDHQAFQHASETANPSDEMKVLLDPKFHEHDAYTMFSLLMET-AEP 255

  Fly   196 YFI--------------------------PGLEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPL 234
            :|.                          |.:.::.....|.:.|:||....:|.||.:.::.|.
Zfish   256 WFSSFEREVRKGKEEMLTSIPFARPQDSGPSVAIVTKVNRIQDQLIKKHDIELYMHLNRLEIAPQ 320

  Fly   235 LYMTDWFLCAMTRTLPWETLLRVWDCFLAEGIRV-----IFKVALVIIGASLSRHKVRKTCTGL 293
            :|...|......|..|.:.||.|||...|:.|.:     :|...|:.|..:|..... :||.||
Zfish   321 IYGIRWVRLLFGREFPLQDLLVVWDALFADSITLDLVDYVFVAMLLYIRDALIASNF-QTCLGL 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 46/225 (20%)
tbc1d5NP_001315187.1 TBC 71..373 CDD:214540 63/311 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.