DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and GAPsec

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster


Alignment Length:339 Identity:66/339 - (19%)
Similarity:116/339 - (34%) Gaps:113/339 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 CPDRNGFYGGFQRTDKPKEPLSKAQIIAREKKWLYMIDNWSIYMSKNYKKIRDRC---------- 74
            |||.:.|.   |.||.|      .:|:...|             .::.:::.:|.          
  Fly   140 CPDISFFQ---QPTDYP------CEIVVHSK-------------GEHGRRLHERVVPAVLSSANV 182

  Fly    75 -RKGIPKSVRPKAWFYLSGAYLLKKKNPNVYNELLEKPGNPTTIEEIKKDKHRQFPFHEMFLDEQ 138
             |||:.          ::...|:.|::...|..:.|  |.....|.:::                
  Fly   183 ERKGLG----------MTKINLITKRSVENYAAMEE--GQEAHWEVVQR---------------- 219

  Fly   139 KVGQIELFNVLKAYSIYNPKVGFCQAQAPIAA--FLLM----------HLPAEDAFWVFVSVCDV 191
                     :|..|:..||..|:.|....|..  :.:|          |..| |.|:.|.::.. 
  Fly   220 ---------ILFIYAKLNPGQGYVQGMNEIVGPIYYVMASDPDLTYRAHAEA-DCFFCFTALMS- 273

  Fly   192 YLQDYFIPGLEVIQNDAGI------LEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLP 250
            .::|:||..|:  ..:.||      |..:||.....:|..|:..::.|..|...|....:::..|
  Fly   274 EIRDFFIKTLD--DAEGGIKFMMARLSNMLKSKDLSIYELLRSQELHPQYYSFRWLTLLLSQEFP 336

  Fly   251 WETLLRVWDCFLAEGIRVIFKVALVIIGASLSRHKVRKTCTGLCETLAVLRSPEEHIVEEEFIIN 315
            ...:||:||...|:..|..|.:               |.|   |..:.:.|   |.|:|.:|..|
  Fly   337 LPDVLRIWDSVFADEQRFDFLI---------------KIC---CSMILIQR---EAILENDFASN 380

  Fly   316 NMMRLNLRVEDFQI 329
            ..:..|....|..:
  Fly   381 VKLLQNYPPIDINV 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 36/180 (20%)
GAPsecNP_648245.2 TBC <191..373 CDD:214540 46/233 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456576
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.