DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and GAPcenA

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001097549.1 Gene:GAPcenA / 38945 FlyBaseID:FBgn0035879 Length:1194 Species:Drosophila melanogaster


Alignment Length:374 Identity:106/374 - (28%)
Similarity:172/374 - (45%) Gaps:40/374 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATAPRSLDTISLCSTVSSCPDRNGFYGGFQRTDKPKEPLSKAQIIARE------KKWLYMIDNW 59
            |....|.:.:.|:.|....||......|     |:|.  ||....::::      .:|..::..|
  Fly   580 MNNLSRIVRSSSIASIEDDCPSDYSSDG-----DEPL--LSGTGEVSKDCSQDTLDEWDPILREW 637

  Fly    60 SIYMSKNYKKIRDRCRKGIPKSVRPKAWFYLSGAYLLKKKNPNVYNELLEKPGNPTTIEEIKKDK 124
            .  ..|..|.:....|.|:|:::|.|.|..|:......:.| :.|..|:.|.....|:  |::|.
  Fly   638 D--SEKRPKNLAPLVRLGVPEALREKIWQKLANVEGRMEMN-DKYKILITKETKCETV--IQRDI 697

  Fly   125 HRQFPFHEMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAEDAFWVFVSVC 189
            ||.||.|:.|.:....||..||.|.|||::::.:||:||..:.|||.||:|:|.||||.|.|::.
  Fly   698 HRTFPAHKCFKEIGGSGQDALFKVSKAYAVHDSEVGYCQGLSFIAASLLLHMPEEDAFCVLVALM 762

  Fly   190 -DVYLQDYFIPGLEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAMTRTLPWET 253
             |..|:|.:..|.||:......||.|:|...|.::.|.....:|..:|.:.|||...|...|...
  Fly   763 YDYGLRDLYKAGFEVLYLRLYQLERLIKDQLPKLHEHFTACGIETHMYASQWFLTLYTARFPLCF 827

  Fly   254 LLRVWDCFLAEGIRVIFKVALVIIGASLS--------------RHKVRKTCTGLCETLAVLRSPE 304
            :..|.|.||.:|:.|:|:||:.::....|              |..:.|.|....:...|::...
  Fly   828 VFHVLDVFLLDGLPVLFQVAVTLLSICESDLRQLDFEGILKYFRVTLPKKCRSSSQARKVMKQAC 892

  Fly   305 EHIV------EEEFIINNMMRLNLRVEDFQIEHTRQKARRAKQKAQQEA 347
            |..:      ||||::....:..|. ::.||...|....|.|.:|:.:|
  Fly   893 ERKIKKLKQYEEEFLLKKQHKERLE-KEAQIYENRFGEERRKMQAEIDA 940

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 62/163 (38%)
GAPcenANP_001097549.1 PTB_Rab6GAP 204..332 CDD:269922
DUF3694 429..523 CDD:289256
TBC 650..858 CDD:214540 74/210 (35%)
Phage_Gp23 <914..991 CDD:287621 8/28 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456587
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.