DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wkd and Tbc1d2

DIOPT Version :9

Sequence 1:NP_650089.1 Gene:wkd / 41390 FlyBaseID:FBgn0037917 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_006538109.1 Gene:Tbc1d2 / 381605 MGIID:2652885 Length:923 Species:Mus musculus


Alignment Length:374 Identity:105/374 - (28%)
Similarity:165/374 - (44%) Gaps:65/374 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DTISLCSTVSSCPDRNGFYGGFQRTDKPKEP---LSKAQ--------IIAREKKWLYMIDNWS-- 60
            |::.| |.||...|    ||.....|...|.   |:|.|        ::|.|.....:.|.|:  
Mouse   545 DSVGL-SPVSEYDD----YGFLTVPDYEMEDLKLLAKIQALEVRSHHLLAHEAVERPLRDRWATL 604

  Fly    61 --IYMSKNYKKIRDRCRKGIPKSVRPKAWFYLSGAYLLKKKNPNVYNELL------EKPGNPTTI 117
              :..|...|::   .|.|:|:..||:.|.:|....:...:.|..|.|||      |.|    ..
Mouse   605 TELTPSAELKQL---LRAGVPREHRPRVWRWLVHRRVRHLQAPGCYQELLARGRACEHP----AA 662

  Fly   118 EEIKKDKHRQFPFHEMFLDEQKVGQIELFNVLKAYSIYNPKVGFCQAQAPIAAFLLMHLPAED-A 181
            .:|:.|.:|.||.::.|.........:|..||.|:|..||.:|:||....:||..|:.|..|: |
Mouse   663 RQIELDLNRTFPTNKHFTCPTSSFPDKLRRVLLAFSWQNPTIGYCQGLNRLAAIALLVLEDEESA 727

  Fly   182 FWVFVSVCDVYL-QDYFIPGLEVIQNDAGILEGLLKKTCPPVYRHLQKHKVEPLLYMTDWFLCAM 245
            ||..|::.:..| .:|:...|...|.|..:|:.||.:..|.:..||.:|:|:..|...:|||...
Mouse   728 FWCLVAIVETILPAEYYSKTLTASQVDQRVLQDLLSEKLPRLTAHLGQHRVDLSLITFNWFLVVF 792

  Fly   246 TRTLPWETLLRVWDCFLAEGIRVIFKVALVI----------IGASLSRHKVRKTCT-GLCETLAV 299
            ..:|..:.||||||.||.||.:|:|:.||.|          :..||..::..:..| .:|::..:
Mouse   793 ADSLISDILLRVWDAFLYEGTKVVFRYALAIFKYNEEAILQLQDSLEIYQYLRFFTKTICDSRKL 857

  Fly   300 LRSPEEHIVEEEFIINNMMRLNLRVEDFQIEHTRQKARRAKQKAQQEAE 348
            :          ....|:|       ..|.::..||  .||..:.:.|||
Mouse   858 M----------SIAFNDM-------NPFPMKQLRQ--LRAAHRERLEAE 887

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wkdNP_650089.1 RabGAP-TBC 114..277 CDD:366170 58/174 (33%)
Tbc1d2XP_006538109.1 PH_TBC1D2A 45..146 CDD:269966
PRK14951 <192..404 CDD:237865
COG4913 <300..>565 CDD:227250 8/24 (33%)
TBC 620..832 CDD:214540 71/215 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.